KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1147Help
Entry
Rsph17029_1147    CDS       T00484                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00010  Glycolysis / Gluconeogenesis
rsh00020  Citrate cycle (TCA cycle)
rsh00620  Pyruvate metabolism
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
rsh01120  Microbial metabolism in diverse environments
rsh01130  Biosynthesis of antibiotics
rsh01200  Carbon metabolism
Module
rsh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17029_1147
   00020 Citrate cycle (TCA cycle)
    Rsph17029_1147
   00620 Pyruvate metabolism
    Rsph17029_1147
Enzymes [BR:rsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rsph17029_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABN76257
UniProt: A3PIU1
Position
1:complement(1188556..1189884)
Genome map
AA seq 442 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDIIAEIETDKATMEFEAVDEGILGKIL
IAEGTAGVKVNTPIAVLVEEGESVDAVSSAKVPEPQEPADEAAPAQEAPKAAPAPAAKAP
EAQAARSEGERVFASPLARRIAKEKGIDLAAVQGSGPRGRIVKADVEGARPSAAPAAKAD
VAAPKAEAPAAAAAPVAAPAASAASVAKLFADRDYEEVTLDGMRKTIAARLSEAKQTIPH
FYLRREVALDALMAFRADLNAKLESRGVKLSVNDFIIKACAVALQQVPNANAVWAGDRIL
RLKPSDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFA
ISNLGMFGVENFDAVINPPHGSILAVGAGIRKPVVGKDGAITTATMMSMTLSVDHRVIDG
ALGAEFLKAIVENLENPIAMLA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgagatcctgatgcccgcgctgtctccgacgatggaggaggggacgctcgcg
aaatggctgaagaaggaaggggatgaggtccgctcgggcgacatcatcgccgagatcgag
accgacaaggccaccatggagttcgaagcggtcgacgagggcatcctcggcaagatcctg
atcgccgagggcacggcaggcgtgaaggtcaacacgcccatcgccgtgctggtggaagag
ggcgagagcgtggacgccgtgtcctccgccaaggtgccggagccgcaggaaccggccgac
gaggccgcgcccgcgcaggaggctccgaaggcggcccctgccccggccgccaaggcgccc
gaggcgcaggcggcccggtccgagggagagcgcgtcttcgcctcgccgctcgcccgccgg
atcgccaaggagaaggggatcgaccttgccgcggtgcagggctcgggcccccgcggccgg
atcgtgaaggccgatgtcgagggggcgcgaccctcggccgcgcccgccgccaaggcggat
gtcgcggcaccgaaggcagaagcgcccgccgctgcggccgcgcccgtcgccgcgccggcc
gcctccgcggcttcggtggcgaagctcttcgcggatcgcgactatgaggaagtgacgctc
gacgggatgcgcaagaccattgccgcgcgtctctccgaggccaagcagaccatcccgcac
ttctacctccggcgcgaggtggctctggatgcgctgatggccttccgcgccgatctcaac
gcgaagctcgagagccggggagtgaagctctcggtcaacgacttcatcatcaaggcctgt
gcggtggcgctccagcaggtgccgaacgcgaatgccgtctgggccggtgaccggatcctg
cggctgaagccctcggacgtggcggtggccgtggccatcgagggcgggctcttcacgccg
gtcctgcgcgatgcgcaccagaagagcctgtcggcgctgtcggccgagatgaaggatctc
gccgcccgcgcccgcacgaagaagctcgcgcctcacgaatatcagggcggcagcttcgcg
atctcgaacctcggcatgttcggggtggagaatttcgatgcggtcatcaacccgccgcac
ggctcgatcctcgccgtcggggcaggcatccgcaagccggtggtgggcaaggacggggcg
atcacgaccgccaccatgatgtcgatgacgctctcggtggaccaccgggtgatcgacggc
gcgctgggggccgagttcctgaaggcgatcgtcgagaatctcgagaacccgatcgcgatg
ctggcctga

DBGET integrated database retrieval system