KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1366Help
Entry
Rsph17029_1366    CDS       T00484                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00900  Terpenoid backbone biosynthesis
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
rsh01130  Biosynthesis of antibiotics
Module
rsh_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rsph17029_1366
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rsph17029_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: ABN76476
UniProt: A3PJG0
Position
1:1419994..1421178
Genome map
AA seq 394 aa AA seqDB search
MRSLSIFGATGSIGESTFDLVMRKGGPEAFRTVALTGGRNIRRLAEMARALKAELAVTAH
EDCLPALREALAGTGTEVAGGAQAIAEAADRPADWTMSAIVGAAGLVPGMRALKHGRTLA
LANKESLVTAGQLLMRTAEENGATILPVDSEHSAVFQALAGEDTACVERVIITASGGPFR
DWSLERIRACTVAEAQAHPNWSMGQRISIDSASMFNKALELIETREFFGFEPDRIEAVVH
PQSIVHAMVGFCDGGLMAHLGPADMRHAIGFALNWPGRGEVPVARIDLAQIASLTFQKPD
EERFPALRLARDVMAARGLSGAAFNAAKEIALDHFIAGRIGFLDMAAVVEETLAGVSTDP
LFGKVPDALEEVLAMDHLARRAAEEAAGLRQQKR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcctgtcgatctttggggccaccggctccatcggcgaatccaccttcgacctc
gtcatgcggaagggcgggcccgaggcgttccgcaccgtcgctctgaccggcgggcgcaac
atccggcggctcgccgaaatggcgcgcgcgctgaaggcggagctcgccgtcaccgcgcat
gaggattgcctgcccgcgctgcgcgaggcgctggccgggacgggcaccgaggtcgcgggc
ggggcgcaggccatcgccgaggccgccgaccggcccgccgattggaccatgtcggccatc
gtgggcgccgcgggcctcgtgcccggaatgcgggctctgaagcatggccgcacgctggcg
ctcgccaacaaggaaagcctcgtgacggcagggcagctcctgatgcgcacggccgaggag
aacggcgccacgatcctgccggtggacagcgagcactccgcggtctttcaggcgctggcg
ggtgaggacacggcctgcgtcgagcgcgtcatcatcacggcgtccggcgggccgttccgc
gactggagcctcgagcgcatccgcgcctgcaccgtggccgaggcgcaggcccatcccaac
tggtccatgggccagcggatctccatcgacagcgcctcgatgttcaacaaggcgctcgag
ctgatcgagacgcgcgaattcttcggcttcgagccggaccggatcgaggcggtcgtccat
ccgcaatccatcgtccacgcgatggtgggcttctgcgacgggggcctcatggcccatctc
ggcccggccgacatgcgccacgccatcggattcgcgctgaactggcccggacgcggcgag
gtgccggtcgcccggatcgacctcgcacagattgcgagcctcaccttccagaagcctgac
gaggaacgctttccggccctgaggcttgcgcgagacgtcatggcggcgcgcggcctgtcg
ggcgccgccttcaacgcggccaaggagatcgcgctcgatcatttcatcgccggtcgcatc
gggtttctggacatggcggcggtggtcgaggagaccctcgcgggcgtttcgaccgacccc
ctgttcggaaaagtgcccgacgcccttgaggaagtgctggccatggaccatctcgctcgg
agagcggcagaggaagccgccggtctccgccagcagaaaaggtag

DBGET integrated database retrieval system