KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2284Help
Entry
Rsph17029_2284    CDS       T00484                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00340  Histidine metabolism
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
rsh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rsph17029_2284
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rsph17029_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABN77386
UniProt: A3PM20
Position
1:complement(2413981..2415285)
Genome map
AA seq 434 aa AA seqDB search
MPQFLDTRRPGFEADFTALLGMKREDSPDVDAVVAGIIADVRARGDAAVIELTARFDRLE
LTPERLAFSEAEIEAEIATVSAEDRAALELAAERIRAYHARQMPENARWTDAAGAELGWR
WGPIASAGLYVPGGLASYPSSVLMNAIPARVAGVERLVVACPTPGGVVNPLVLLAARLAG
VDAVYRIGGAQAVAALAYGTETIRPVDKITGPGNAYVAAAKRRVFGRVGIDMIAGPSEIL
VIAEGAVDPDWIALDLLSQAEHDESAQSILVTPDEALGRAVVQAVEARLETLERRAIAGA
SWRDYGAVIVTRDLEEAAALSDRVAPEHLELYVADPEALAARIRHAGAIFLGAWTPEAIG
DYVGGPNHVLPTARSARFSSGLSVMDFLKRTTLARMTPAALRAVGPAAERLAISESLEAH
GLSVRARLDRLNEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtttctcgacacccgtcggcccggcttcgaggcggatttcaccgcgcttctc
ggcatgaagcgcgaggacagccccgatgtcgatgcggtggtggccgggatcatcgcggat
gtgcgggcgcgcggggatgcggcggtgatcgagctgaccgcgcggttcgaccggttggag
ctgacgcccgaacggcttgccttctcggaggcggagatcgaggcggagatcgcgaccgta
tctgccgaggaccgcgcggcgctggagctcgcggccgagcggatccgggcctatcacgcg
cgccagatgccggagaatgcgcgctggaccgatgcggccggcgccgagctcggctggcgc
tgggggcccatcgcctcggccgggctctatgtgccgggggggcttgcctcctatccgtcc
tcggtgctgatgaatgcgatccccgccagggtcgcgggggtggagcggctggtcgtggcc
tgcccgacgccgggcggcgtggtcaatccgctggtgctgctggccgcgcggctggcgggc
gtggatgcggtctacaggatcggcggggcgcaggcggtggcggcgctggcctacggcacc
gagacgatccggccggtcgacaagatcaccggcccgggcaatgcctatgtggcggcggcc
aagcggcgggtcttcggccgggtggggatcgacatgatcgcgggcccctccgagatcctc
gtgatcgcggaaggcgcggtcgatcccgactggatcgcgctcgaccttctgagccaggcc
gagcatgacgagagcgcgcagtcgatcctcgtcacgcccgacgaggcgctcggccgggcc
gtcgtgcaggcggtcgaggcgcggctcgagacgctcgagcggcgggcgatcgcgggcgcc
tcgtggcgcgactacggggcggtgatcgtgacgcgcgatctggaggaggcggcggcgctg
tcggaccgggtggcgcccgagcatctcgaactgtacgtggccgatcccgaggcgctggcg
gcgcggatccgccatgcgggggcgatctttctcggcgcctggacgcccgaggcgatcggc
gactatgtgggcgggccgaaccatgtgctgcccaccgcccgctcggcgcgcttctcgagc
ggcctgtcggtgatggatttcctcaagcgcaccacgctcgcccggatgacgcccgcggcg
ctgcgcgccgtgggccccgccgccgagcggctggccatttcggagagcctcgaggcgcac
ggcctgtcggtccgcgcccggctcgaccggctgaacgagggctga

DBGET integrated database retrieval system