KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2374Help
Entry
Rsph17029_2374    CDS       T00484                                 

Definition
(GenBank) phosphatidylserine decarboxylase related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00564  Glycerophospholipid metabolism
rsh01100  Metabolic pathways
rsh01110  Biosynthesis of secondary metabolites
Module
rsh_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rsph17029_2374
Enzymes [BR:rsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Rsph17029_2374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ABN77476
UniProt: A3PMB0
Position
1:2511556..2512254
Genome map
AA seq 232 aa AA seqDB search
MAIDLLSTFIKPMHREGTKFVAIFAVVTLVLFLIWEPLGWIGVGLTVWCYYFFRDPVRVT
PTREGLIVSPADGVVSLIEPAVPPAELGMGPAPMTRVSVFMNVFDCHVNRAPIGGTVTAV
AYRPGKFLNASLDKASEDNERNALAIRLADGRQIAVVQIAGLVARRILCEVREGTPLLTG
ERFGMIRFGSRLDVYLPEGVQPLVCLGQVMTSGETVLADLTSPEARRTGAAR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgacctgctctcgaccttcatcaagccgatgcaccgcgagggcaccaagttc
gtcgccatcttcgccgtggtcacgctcgtcctgttcctgatctgggagccgctcggctgg
atcggcgtgggcctcacggtctggtgctactacttcttccgcgatccggtgcgcgtcacg
ccgacgcgtgaggggctgatcgtaagcccggccgacggggtcgtgtcgctgatcgagccc
gccgtgccgccggccgagctcggcatgggccccgcgcccatgacccgcgtctcggtcttc
atgaacgtcttcgactgccatgtgaaccgtgcgcccatcggcggcacggtgacggccgtc
gcctatcgtccgggcaagttcctgaacgcctcgctcgacaaggcgagcgaggacaacgag
cgcaatgcgctggcgatccgtctcgccgacggccgccagatcgccgtcgtgcagatcgcg
ggcctcgtggcgcgccggatcctctgcgaggtgcgcgagggcacgccgctgctgacgggc
gagcggttcgggatgatccgcttcggctcgcggctcgacgtctatctgcccgagggcgtg
cagccgctcgtctgcctcggtcaggtcatgacctcgggcgagaccgtgcttgccgacctc
accagcccggaggcgcgccgcaccggcgcggcgcgctga

DBGET integrated database retrieval system