KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3121
Entry
Rsph17029_3121    CDS       T00484                                 

Definition
(GenBank) Uncharacterised conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsh02044]
    Rsph17029_3121
Secretion system [BR:rsh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rsph17029_3121
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABN78221
UniProt: A3PPF5
Position
2:137227..137757
AA seq 176 aa
MSESKAKVIERNRAPRVQIAYDVEHYGSPTTIELPFVMGVMADLAGKSETREAQKPAAER
AFVEVDAGRFGKFMEALSPRVKARVPNRLPGGAEGGEEEMFVDLSFRSMGDFAPDRMAEQ
VPALAELLRMRRQLEELLGYMDGKVSAEKRIAQLLTNEPLLAQVAGEAVKSRQAEE
NT seq 531 nt   +upstreamnt  +downstreamnt
atgagcgagagcaaggcgaaggtgatcgaacgcaaccgcgctccgcgggtgcagatcgcc
tatgacgtggagcattacggcagcccgaccaccatcgagctgcccttcgtgatgggggtc
atggccgacctcgccggcaagtccgagacgcgcgaggcgcagaagcccgcggccgagcgg
gccttcgtcgaggtggatgccggccggttcggcaagttcatggaggcgctgagcccgcgg
gtgaaggcacgggtcccgaaccggctgcccggcggggcggagggcggcgaggaggagatg
ttcgtcgatctcagcttccgcagcatgggcgatttcgcccccgaccgcatggccgaacag
gtgccggcgctggccgagctcctgcggatgcggcgccagctcgaagagcttctgggctac
atggacggcaaggtcagtgccgagaagcgcatcgcccagcttctgacgaacgagccgctg
ctcgcgcaggtcgcgggcgaggccgtgaagtcgcgtcaggcggaggaatga

DBGET integrated database retrieval system