KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3128
Entry
Rsph17029_3128    CDS       T00484                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rsph17029_3128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsh02044]
    Rsph17029_3128
Secretion system [BR:rsh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rsph17029_3128
SSDB
Motif
Pfam: T6SS-SciN LPAM_1
Other DBs
NCBI-ProteinID: ABN78228
UniProt: A3PPG2
Position
2:144597..145049
AA seq 150 aa
MADRRMFLAGAGALLLVAGCGGPKAGTLTVSATGTAGMNPGPDGSDRPLTIQILQLRGTA
AFDAADAFALQSPATSLGADLLKADLVTLMPGAPVVRAIPLDPSVAAVGVVAGFRSAGGR
SYRYSFSVAPTAEVALKIDVGQGGLVVVQG
NT seq 453 nt   +upstreamnt  +downstreamnt
atggctgacagacgcatgttccttgcgggcgcgggggcgcttttgctcgtggcgggctgc
ggggggcccaaggccggcacgctcaccgtcagtgccacgggcacggccggcatgaacccc
ggccccgacgggagcgaccggccgctgacgatccagatcctgcagctgcgcggcaccgcg
gccttcgacgcggccgacgccttcgcgctccagtcgccggcgacgagcctcggcgcggac
ctgctcaaggcggatctcgtgacgctgatgccgggcgcgccggtcgtgcgggcgatcccg
ctcgacccgtcggtggcggccgtcggcgtggtcgcgggcttccgcagcgcgggcggacgc
agctaccgctacagcttcagcgtcgcgcccaccgccgaggtggcgctgaagatcgacgtg
ggccaggggggcctcgtcgtggtgcagggctga

DBGET integrated database retrieval system