KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3129
Entry
Rsph17029_3129    CDS       T00484                                 

Definition
(GenBank) protein of unknown function DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsh02044]
    Rsph17029_3129
Secretion system [BR:rsh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rsph17029_3129
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ABN78229
UniProt: A3PPG3
Position
2:145058..146386
AA seq 442 aa
MSGNRVVWSEGLFLRTQHFQQQDRHAEALLRAALLAAPWQPFGFTRLALDAAALDAGRVA
LAEAEALMPDGTAFRLAEAEPPPAAALRRDGPPGLVQLALPLEQEGAASVDPAHAAPSGA
RYRGRIEVLRDAIRGGAEPEEVELARLAPRLIAPGEPADGCVTLPVARVEGLRADGSVAL
QEGWLPPALTIGAVPWYGALLQELVTGLDRVADAHGGLVLGGAGRSIENLLILELANTAR
PRLAHLLQQAQEHPSALYAELAALAGRMATYGSSSRRLSALAPYDHLEPQPAFAALADTL
RSLLLSLRHVEPKSRALPVARHAQNIWKVRIDNPEILRSSRIVLRVGSEMSDESLRRLFA
DQATVGAADAFERLWTSRLPGIPLKPLHSQPREIPYDGERLCLELDQKSEHWSQLLEAPG
FVVGVSGVLEREPQIDCYAVSR
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgagcggcaacagggtggtctggtcggaagggctcttcctcaggacccagcacttccag
cagcaggaccggcacgccgaggcgctgttgcgcgcggcgcttcttgcggcgccctggcag
cccttcggcttcacgaggctcgcgctcgatgcggcggcgctcgacgcaggccgcgtggcg
ctcgccgaggcggaggcgctgatgccggacggcacggccttccgcctggccgaggccgag
ccgccgccggccgcggcgctccgccgcgacgggccgccgggcctcgtccagctggcgctg
ccgctcgaacaggagggggcggcgagtgtcgatcccgcccatgccgcaccttcgggggcg
cgctaccgcgggcggatcgaggtgctgcgcgatgcgatccgcggcggcgccgagcccgag
gaggtggagctcgcgcggctcgccccgcgcctgatcgcgccgggagagcccgcggacggc
tgcgtgacgctgcccgtggcgcgcgtcgaggggctgcgcgcggacggatcggtggccctg
caggagggatggctgccccctgccctcaccatcggcgccgtgccgtggtatggcgcgctg
cttcaggagctggtgacggggctcgaccgggtggccgatgcccatggcgggctcgtgctg
ggcggcgccgggcgctcgatcgagaacctgctgatcctcgaactggccaacaccgcgcgc
ccgcgcctcgcccacctgctccagcaggcgcaggaacatccctcggcgctctatgccgag
ctggccgcgctcgccgggcggatggcgacctacggctcctcctcgcgccggctgagcgcg
cttgcgccctacgaccatctcgagccgcaaccggccttcgcggctctggccgacacgctg
cgttcgcttcttctgtcgctgcgccatgtcgagccgaagtcgcgcgcgctgccggtggcg
cgccatgcgcagaacatctggaaggtccgcatcgacaatcccgagatcctgcgctcctcg
cgcatcgtgctgcgcgtgggctcggagatgtcggacgagagcctgcgccggctcttcgcc
gatcaggcgacggtgggcgcggccgatgccttcgagcggctctggacctcgcgcctgccg
ggcatcccgctgaagccgctccattcccagccgcgcgagatcccctacgacggcgagcgg
ctctgcctcgagctcgatcagaaatccgagcactggtcgcagttgctcgaggcgccgggc
ttcgtggtgggggtttcgggcgtgctcgagcgcgagccgcagatcgattgctatgcggtg
agccgatga

DBGET integrated database retrieval system