KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3130
Entry
Rsph17029_3130    CDS       T00484                                 

Definition
(GenBank) OmpA/MotB domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rsph17029_3130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsh02044]
    Rsph17029_3130
Secretion system [BR:rsh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rsph17029_3130
SSDB
Motif
Pfam: DotU OmpA DUF5337
Other DBs
NCBI-ProteinID: ABN78230
UniProt: A3PPG4
Position
2:146451..147812
AA seq 453 aa
MTREDDPFGLATDAARTRIRPSPAERARRAAAGPAPAEVGAVAPVRPAHGRTHPNPLVAS
FAVLLELAPALEGAAPPQEPGMLRARLRDGLTEARDRSVAQGVPLARADRAAWFVAALLD
DLALNTPWGAASGWPRQPLVTELSGEVDAGTRFFDRLEELARHPTLDPQLLELVWLCLSL
GFRGKHRTGREGGESALFALRTGVARLLRNPEATAAPLSPHWEGVAAPDAPRRFAVPVWT
VGLAALALMAALYTGLSLQLSARAEKLFDLAALVPPAERAALFRPPRETVAPPPEIRVEP
VVIELLPAFRARAPAATAAALQGREDAQLTILTLQGTDPELFRSARAEVNPDYAPLVASV
AAVLAENRELVGAVRVIGHTDNVPVQRSNPFASNQGLSEARAATLAALLVEGGVPAGIVT
AEGHADTEPVADNATRAGRAQNRRVEIRIEKRL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgacgcgggaggacgatccgttcggtctggcgaccgatgccgcccgcacccggatcagg
ccctctcctgccgaacgggcgcgccgggccgcggccgggcccgctccggccgaggtgggc
gccgtggccccggtccgcccggcccacgggaggacccatcccaatccgctcgtcgcgagc
ttcgccgtcctgctcgaactcgcgcctgcgctggaaggcgccgccccgccgcaggagccg
gggatgctgcgcgcgcggctccgcgacggtctgaccgaggcccgcgaccggagcgtggcg
cagggcgtgccgctggcccgcgccgaccgcgccgcgtggttcgtggcagcgctcctcgac
gatctggccttgaacacgccctggggtgcggccagcggatggccgcgccagccgctcgtg
accgagctgtcgggcgaggtcgatgcgggcacccgcttcttcgaccgcctcgaagagctc
gcgcgccatccgacgctcgacccgcagcttctggagctggtctggctctgcctgtcgctc
ggctttcgcggcaagcaccgcacggggcgcgagggcggcgagagcgcgctcttcgcgctc
cgcaccggcgtggcgcgccttctgcgcaatccggaggctacggccgcgccgctctcgccg
cactgggagggggtcgcggcgcccgacgcgccgcgccgcttcgcggtgccggtctggacg
gtgggactcgcggcgcttgcgctgatggccgccctctacacgggcctctcgctccagctg
tcggcgcgggccgagaagctcttcgatctggcagccctcgtgcccccggccgagcgcgcg
gccctgttccgccccccgcgcgagacggtcgcgccgccgcccgagatccgggtggagccg
gtggtgatcgagcttctgcccgccttccgggcccgcgcccccgccgccaccgcggccgcc
cttcagggccgcgaggatgcgcagctcaccatcctcacgctgcagggcacggaccccgag
ctgttccgctcggcccgcgccgaggtgaacccggactatgcgccgctggtggcctcggtc
gcggccgtcctcgccgagaaccgcgagctggtgggggcagtccgtgtcatcggccatacc
gataacgtgccggtccagcgcagcaatcccttcgcctcgaaccagggcctgtccgaggcc
cgcgccgccactctcgcggccctcctcgtcgagggcggcgtgcccgcggggatcgtcacc
gccgaaggccatgccgacaccgagccggtcgccgacaatgccacgcgcgcgggccgggcg
cagaaccgccgcgtcgagatccgcatcgagaagaggctctaa

DBGET integrated database retrieval system