KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3133
Entry
Rsph17029_3133    CDS       T00484                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rsph17029_3133
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsh02044]
    Rsph17029_3133
Secretion system [BR:rsh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rsph17029_3133
SSDB
Motif
Pfam: Phage_GPD Gp5_C Phage_base_V
Other DBs
NCBI-ProteinID: ABN78233
UniProt: A3PPG7
Position
2:complement(151824..154127)
AA seq 767 aa
MSEAREITLSLPAAAEDLWFSALEGEDGLGRPFHYELLLASKSLDLAAADILGTPVLVTV
RGEVPRHFHGIATAFGLDEIRDDHAHYRLTMEPSMALLGLRRDNRIFQDRSVPEILEAVL
SEIPGLDWDFRLQASYPPRDYCVQYGETDLDFVQRLMEHEGIGYFFEHGAEGHRLVLFDT
NARLAPAPGAEILPYEPDSRVSFRDGDFITAWLPRAHIRPGKVSQGDYDFEKPSSDLTSR
AENPLGHAADDAEHYRWPGDYRTLPAGDRLSRLRLEEAQALQVRIEARGTARPLWPGRIF
RLDLFPREAENDDYLVTACRYRLWDDQFRSGQSRAEVGYEVDLSLVPARVPYRPERRTPR
PVMKGPQTALVVGPAGAEIFTDRYARVKVHFFWDRLDARNEASSCFVRVSQTWAGAGWGF
IQIPRIGQEVIVDFIEGDPDRPIVTGRVYNAEQMPPYGLPGQATQSGWKSHSSPGGGGWN
ELRFEDKAGAEEVYFQAQKDHTELIKNDESRTIGHDFAEDVGHDAVQSVAHDRRESVGND
KDTSVGRNRTVSIGVDDSESVGANRALRVGADETIAVARNATETIGMNHTQTVGIAQTVT
VGAARTDSVGGAETRSVGAVQTNTIAASRSVSVGAGQTHSVGADDGWTVGGSQTVSVGAD
QSVTVGAKQTVSTGSDQVTTVGGSRATQVAKDDLQKADGAMGIGVGKSYTLDVKDEITLK
CGSAEITLKKDGTIVLKGKDITLDTSGKINLKAGGEITCKGSKINLN
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtccgaggcccgcgaaatcaccctgtccctccccgctgcggccgaggatctatggttc
tcggcgctcgagggcgaggacgggctggggcgcccgttccactacgagttgctcctcgcc
agcaagtcgctcgatctcgccgcggccgacatcctcggcacgccggtgctggtgacggtg
cggggcgaggtgccgcgccatttccacggcattgccaccgccttcgggctcgacgagatc
cgcgacgaccatgcccactaccggctgacgatggagccctccatggcgctcctcgggctg
cggcgcgacaaccggatctttcaggaccggtcggtgcccgagatcctcgaggccgtcctg
agcgagatccccggtctcgactgggatttcaggctgcaggccagctatccgccgcgcgac
tactgcgtgcagtatggcgagaccgatctcgatttcgtgcagcggctgatggagcatgag
gggatcggctatttcttcgagcatggcgcggagggccacaggctcgtcctcttcgacacg
aatgcccggctcgcgcctgcaccgggggccgagatcctgccctacgagcccgacagccgg
gtgagcttccgcgacggcgatttcatcaccgcctggttgccccgggcgcatatccggccg
gggaaggtctcgcagggcgactacgatttcgagaagccctcgtcggacctgacgagccgc
gccgaaaatccgctcggccatgcggccgacgatgccgagcactatcgctggcccggggat
taccgcacccttcccgcgggcgaccggctgtcccggctccggctcgaggaggcgcaggcc
ctgcaggtgcgcatcgaggcccgcggcaccgcgcggccgctctggccgggccggatcttc
cggctcgatctcttcccgcgcgaggcggagaacgacgactatctcgtcaccgcctgccgc
taccggctctgggacgatcagttccgctcgggtcagtcgcgcgccgaggtgggctacgag
gtggatctgtcgctcgtccccgcccgcgtcccctaccggcccgagcggcgcaccccgcgc
ccggtgatgaaggggccgcagaccgccctcgtggtcgggccagcgggcgcggagatcttc
accgacagatatgcgcgggtgaaggtgcatttcttctgggaccggctcgacgcccgcaac
gaggcctcctcctgcttcgtccgcgtgagccagacctgggccggggccggctggggcttc
atccagatcccccggatcgggcaggaggtcatcgtcgatttcatcgagggcgaccccgac
cggcccatcgtcacgggccgggtctacaatgccgagcagatgccgccctacggcctgccg
ggccaggccacccagtcgggctggaagtcgcattcctcgcccggaggcggcggctggaac
gagctgcgcttcgaggacaaggccggcgcggaggaggtctatttccaggcgcagaaggac
cataccgagctcatcaagaacgacgaaagccgcaccatcggccacgatttcgccgaggat
gtgggccatgacgccgtgcagtccgtggcgcacgaccgccgggagagcgtgggcaacgac
aaggacacgagcgtgggccggaaccgcaccgtctcgatcggcgtcgacgacagcgagagc
gtgggcgcgaaccgcgcgctgcgggtcggcgcggacgagacgatcgcggtggcgcggaat
gcgaccgagaccatcggcatgaaccacacccagacggtcggcatcgcccagacggtgacg
gtcggggcggcgcgcaccgacagcgtcggcggggccgagacgcgctcggtcggcgcggtc
cagaccaacaccatcgccgcaagccgcagcgtttcggtcggtgcgggccagacccattcg
gtgggcgccgacgacggctggaccgtgggcgggtcgcagaccgtctcggtcggcgcggac
cagtcggtgacggtgggggcgaaacagacggtcagcaccggctcggatcaggtgaccacc
gtcggcggctcccgcgccacgcaggtggccaaggacgacctgcagaaggccgatggcgcc
atgggcatcggcgtgggcaagagctacacgctcgacgtcaaggacgagatcaccctgaaa
tgcggctcggccgagatcacgctgaagaaggacggcaccatcgtcctcaagggcaaggac
atcacgctggacacctcgggcaagatcaacctcaaggcgggcggcgagatcacctgcaag
ggctcgaagatcaacctgaactga

DBGET integrated database retrieval system