KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3545Help
Entry
Rsph17029_3545    CDS       T00484                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Rsph17029_3545
Enzymes [BR:rsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Rsph17029_3545
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Rsph17029_3545
    1.1.1.-  
     Rsph17029_3545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ThiF Sacchrp_dh_NADP Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABN78636
UniProt: A3PQM0
Position
2:complement(632192..633229)
Genome map
AA seq 345 aa AA seqDB search
MRACVIRAARDLSIEPWAEPALQAGEVRLDLAWGGICGSDLHYFQHGRVANSILREPMIL
GHEFSGRIREVGPGVQWLKPGMAVAVNPSRPCGSCDQCSAGLTHLCRSMRFMGSAAHFPH
THGGFAERPVVLASQCVALPETVDLALAALSEPYAVALHAVELAQIAAGASVLVTGAGTI
GSLVAVAARQAGAGRLIVTDIAEPALARVRKVTGAETHLVGDPEATRAAEAAIGEVDVVL
EASGVSAALDMAIRCIRPRGRIVQVGFLPPEARLSLAGLLIREATLVGAYRFLGEFDEAV
RQISTGAVDLAPFVTARFGMDAAEEAFAAAADRTHNVKVLLSFGS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcttgtgtcatccgtgccgcaagggatctgagcatagagccgtgggccgagccc
gcgctgcaggcgggcgaagtccgtctcgatctcgcctggggcgggatctgcggctcggac
ctgcattatttccagcatgggcgggtggcgaactcgatcctgcgggagccgatgatcctc
ggccacgagttcagcggccggatccgcgaagtggggccgggcgttcaatggctcaagccg
gggatggccgtggcggtgaatccctcgcggccgtgcggcagctgcgaccagtgcagcgcg
ggcctgacccatctctgccgctccatgcgcttcatgggcagcgccgcgcatttcccccat
acccacggcggatttgccgagcggccggtggtgctggcctcgcaatgcgtggcgctgccg
gaaacggtcgatctggccctcgccgcgctgagcgaaccctatgcggtggcgcttcatgcg
gtggaactggcgcagatcgcggcgggcgcgtcggtgctggtgacgggtgcgggcaccatc
ggcagtctggtggcggtggccgcccggcaggcgggcgcgggccgcctgatcgtgaccgac
atcgccgagccggcactggcccgcgtccgaaaggtgacgggcgccgagacgcatctggtg
ggcgatcccgaggccacccgtgccgccgaggccgccatcggcgaggtcgatgtggtgctg
gaggcttcgggcgtgtcggcggcgctcgacatggcgatccgctgcatccgtccgcgcggc
cgcatcgtgcaggtgggcttcctgccccccgaggccaggctctcgctggccggcctcctg
atccgcgaggccacgctggtgggcgcctatcgcttcctcggagaattcgacgaggcggtg
cggcagatctcgaccggcgcggtggatctcgcgcctttcgtgaccgcgcgcttcggcatg
gacgcggccgaagaggccttcgccgccgccgcggaccggacgcacaacgtcaaggtcctg
ttgagcttcgggagctga

DBGET integrated database retrieval system