KEGG   Runella slithyformis: Runsl_0094Help
Entry
Runsl_0094        CDS       T01553                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rsi  Runella slithyformis
Pathway
rsi00010  Glycolysis / Gluconeogenesis
rsi00030  Pentose phosphate pathway
rsi00051  Fructose and mannose metabolism
rsi00052  Galactose metabolism
rsi00680  Methane metabolism
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01120  Microbial metabolism in diverse environments
rsi01130  Biosynthesis of antibiotics
rsi01200  Carbon metabolism
rsi01230  Biosynthesis of amino acids
rsi03018  RNA degradation
Module
rsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Runsl_0094
   00030 Pentose phosphate pathway
    Runsl_0094
   00051 Fructose and mannose metabolism
    Runsl_0094
   00052 Galactose metabolism
    Runsl_0094
  Energy metabolism
   00680 Methane metabolism
    Runsl_0094
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Runsl_0094
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Runsl_0094
Protein phosphatases and associated proteins [BR:rsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Runsl_0094
Messenger RNA biogenesis [BR:rsi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Runsl_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128 Peptidase_M20
Motif
Other DBs
NCBI-ProteinID: AEI46553
UniProt: F8EB52
Position
122331..123308
Genome map
AA seq 325 aa AA seqDB search
MIKKIAVFTSGGDAPGMNACIRAVVRTSMYYGIEVYGIRRGYNGMIAGDIYQMTSHSVSN
IIQRGGTILKSARSKEFMTKEGRQKAFEQLQKFGIEGLVAIGGNGTFTGATIFYDEYGIP
TVGAPGTIDNDLFGTDYTIGYDTAVNTALEAIDKIRDTADSHDRVFFIEVMGRDSGYIAI
QSGIAGGAEIVMVPEVLTPITEVIETLKQGWNRSKSSSIIVVAEGDEEGNAAEVAEKIKS
RVDIDIDIRVTTLGHIQRGGIPTAYDRILASRLGLGAVEGLMNGHKNVMVGIINNEIIYT
PFRDTIRLPKPINEDMLRMVKILST
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattgcggtttttacctcaggcggagacgctcccggtatgaacgcttgc
atccgcgccgtagtccgtacttccatgtattatggaattgaagtatatggtatccgtcgc
ggttacaatggaatgattgccggtgacatttatcagatgacttctcattctgtaagcaat
ataattcagcgtggcggtaccattcttaaatcggcccgcagcaaagaatttatgactaaa
gaaggtcgtcaaaaagcatttgaacaactccaaaaattcggaatcgaaggacttgttgcc
attgggggaaacggaacgtttacgggcgccactattttttacgacgaatacggcatccct
accgtaggtgccccgggaaccatcgacaatgacctcttcggcactgactataccattggt
tatgataccgccgttaatacagccctggaagccattgacaaaattcgcgatactgctgat
tctcacgaccgcgttttctttatagaagtaatgggccgcgactccggctacattgccatt
caatcaggcattgcgggcggggctgaaatcgtgatggttcctgaagtattaacccccatt
acggaggtaatcgaaaccctcaagcagggctggaaccgctcaaagtcttcttctatcatt
gtagtagccgaaggagatgaagaaggtaacgccgccgaagtagccgaaaaaatcaaatca
cgggttgatatcgacattgatattcgcgtaacgacccttgggcacattcagcggggtgga
atcccaaccgcgtatgaccgcatattggccagccgtttgggactcggagccgttgaaggt
ctcatgaacggtcataaaaatgtcatggttggaatcattaataacgaaatcatatacact
cctttcagagatacgatccggttgcctaaacccatcaacgaagatatgcttcggatggtg
aaaattctcagtacatag

DBGET integrated database retrieval system