KEGG   Runella slithyformis: Runsl_0171Help
Entry
Runsl_0171        CDS       T01553                                 

Definition
(GenBank) Butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
rsi  Runella slithyformis
Pathway
rsi00071  Fatty acid degradation
rsi00280  Valine, leucine and isoleucine degradation
rsi00410  beta-Alanine metabolism
rsi00640  Propanoate metabolism
rsi00650  Butanoate metabolism
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01120  Microbial metabolism in diverse environments
rsi01130  Biosynthesis of antibiotics
rsi01200  Carbon metabolism
rsi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Runsl_0171
   00650 Butanoate metabolism
    Runsl_0171
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Runsl_0171
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Runsl_0171
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Runsl_0171
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Runsl_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N AcylCoA_DH_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AEI46628
UniProt: F8EBY3
Position
209545..211344
Genome map
AA seq 599 aa AA seqDB search
MPSFFSKRDLHFHLYELLNVEQLTDYPYFKDHQRESFDMILDAAEQIADKMLRPLLTEMD
RKEPQLINGTIRVHEGMKAVIRRFGDDGWINAGFSYEEGGQQLPVTVQNAAAFIFQAANY
SASVYPFLTTGAANLIRTFGSEALIKRYTPLMYSGRWQGTMALTEPNAGSSLSDISTSAE
PTEEEGVYSIQGQKIFISCGDHDACENVVHLLLAKIKGSPAGTKGISLFVVPKKRITDQG
LIDNGITTAGVYHKMGYKGAPIAHLMFGSDNNCLGYLVGEPHKGLSYMFQMMNEARVGVG
MNAAAIGTAAYYASLAYAKERPQGRPVTAKDPTQPQTLIIHHADVKRMLLFQKSVVEGSL
SLLLQCGFWADLAHVSEGETKERAEILLDMLTPIAKSYPSEMCCQTTSAAVQILGGAGYT
TDFPVEQYYREARIHPIHEGTTGIHGMDLLGRKLLLHGGKGLHYLTEEIQATIDEGRRSS
YPDILNIAAQLQTVLERVDKVTASLLTLSPENKELFLADATLYLEFFGIVTMGWQWLKQA
IQAQKSLEHSKIDGDLNFYRGKLAAADYFFEYEVVKTVSLAQRLMSHNRVTVEMQPDWF
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgccttcattcttctcaaagcgcgaccttcactttcatttatacgaattgctcaatgtt
gagcagcttacggattacccctactttaaggaccatcaaagagagtcattcgacatgata
ctggatgcggccgagcagattgccgataaaatgctgcgtccgctcctgacggagatggac
cgcaaagagccgcagttgatcaatggcaccatacgtgttcacgaaggaatgaaagcagtt
atccgacggtttggagacgacggttggatcaatgccggattttcgtacgaagaaggcgga
cagcaactgcccgttacggttcaaaatgccgctgcatttatttttcaggccgccaattac
tccgccagtgtgtatccttttctgaccacgggtgccgccaatctcattcgcacgttcggt
tctgaagctctgataaaacgctatacccccctcatgtacagcgggcgctggcaaggtacg
atggcactgacagaacccaacgccggcagttcactctccgacatcagtacttctgccgag
cccaccgaagaagaaggggtgtatagcatacaggggcaaaaaatctttatttcctgcggc
gaccacgacgcctgcgaaaacgtagttcatctgttactggctaagatcaaaggcagcccc
gcgggcacaaaaggtatttccctgttcgttgttcctaaaaaacggatcactgaccaagga
ctgattgacaacggcataaccaccgcaggcgtgtatcacaaaatgggctacaaaggagca
cccattgcccaccttatgttcggctcagacaataattgcctgggctatctggttggtgaa
ccgcacaaaggactgagttatatgtttcaaatgatgaacgaagcccgtgtaggggtaggc
atgaacgccgccgcgatcgggaccgccgcctattatgcttcactcgcctatgccaaagaa
cgcccgcagggacggcccgttacggccaaagatcccacgcagccgcaaaccctcatcatt
catcatgccgatgtaaaacgcatgctgctgtttcagaaatcggtggtggaaggctccctt
tcgctgttgttgcaatgcggcttctgggcagatctggcacacgtcagcgagggagagacc
aaagagcgagcggaaatattgctggatatgttaacacccattgccaaatcttacccctcc
gagatgtgctgccaaaccacaagcgcggcggtgcagattctgggcggtgcaggctatacg
accgactttccggtagagcaatattaccgcgaagcacgcattcatcccatccatgaaggc
accacgggtatccacggaatggatttactggggcgcaaattgctccttcacggaggtaaa
gggcttcattatctgaccgaagaaattcaggcaaccattgacgaaggccgcaggtcttcc
tatcctgacatattgaatatagccgcacaattacaaacagttctggaacgggttgataaa
gtaacggcttcattactcacgctttcccctgaaaacaaagaattatttttggccgacgcc
acactctatctggagtttttcggcattgttacaatgggctggcaatggctgaagcaagcc
atccaagcccaaaaaagtctggaacattcgaaaattgacggtgacctgaatttttaccgc
gggaaattagccgccgccgattacttctttgaatatgaagtggtaaagaccgtatctctc
gctcaacggctcatgagtcataaccgcgttacggtcgaaatgcagcccgattggttctga

DBGET integrated database retrieval system