KEGG   Runella slithyformis: Runsl_2125Help
Entry
Runsl_2125        CDS       T01553                                 

Definition
(GenBank) Glycogen(starch) synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
rsi  Runella slithyformis
Pathway
rsi00500  Starch and sucrose metabolism
rsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Runsl_2125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rsi01003]
    Runsl_2125
Enzymes [BR:rsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Runsl_2125
Glycosyltransferases [BR:rsi01003]
 Polysaccharide
  Storage polysaccharide
   Runsl_2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AEI48539
UniProt: F8EDZ8
Position
2450516..2452333
Genome map
AA seq 605 aa AA seqDB search
MEKKTKKALLFEVAWEVCNQVGGIYTVIRSKVPAMVDQWGDDYVCLGPYFPQRALTEYEP
ITSDDGSGIYQTVEKMREAGFAVEYGYWLITGKPRVVLFDIRSMAAQMDRIKYGLWERHQ
ISTVNIEDLVNQTLGFGEMVRVFLTLFAEDYAKKFEITAHFHEWMASSGLPDLRRDDVRI
ATVFTTHATMLGRYIASNERDFYHKLPFFDWKHEARHYGIEAQATVERLAYLSAHVSTTV
SDVTARECEVFLGKYPDLVLPNGLNIQRFAAVHEFQNLHMKYKENIHRFIMGHFFQSYSF
NLDKTLYFFTSGRYEFVNKGYDITMEALARLNWKMVQAKMDMTVVMFIVTKQPYHSMNPD
VLQSRAVLGEIQDTCEAIEKQLGDKLFLASASSTDHHLPDLNQFVDEYWRLRLRRTIQTW
KTKRLPPYVTHDLKQPDSITEYCERSGLKNHEQDRVKIVYHPDFIASTNPLFGLDYGQFV
RGCHLGIFPSYYEPWGYTPLECVVRGIPTVTSDLSGFGDFIMQIMRDYENRGIYVINRKT
QNFDQAADQLANIMFRFVRMNLRERIQQRNKVENISDVFDWGNLRSYYDTAHDLAAKKAF
KTKVN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagaaaactaaaaaagccctcttatttgaagtcgcttgggaagtatgcaaccag
gtgggaggaatttataccgtaatacgcagcaaggtgcctgccatggtcgatcagtggggc
gatgattacgtttgcttgggtccctatttccctcaacgtgctttgacagaatacgaaccc
atcacttccgatgacggttcgggcatttatcagaccgtagagaaaatgcgtgaagccggt
tttgcggtagaatacggctattggctgatcacgggcaagccgcgcgtggtactgtttgat
atacggagtatggccgctcaaatggaccgtatcaagtacggcctctgggagcgtcatcaa
atatctacggtcaatattgaagatttggtcaatcagacgttgggttttggtgaaatggta
cgtgttttcctgacccttttcgcggaagactatgccaagaaattcgagattacggcgcat
tttcacgagtggatggcaagctcgggcttaccggacctgcgtcgggatgatgtacggatt
gcaaccgtatttacgacccatgcgaccatgcttgggcggtatattgcgtccaacgagcga
gatttttaccataagcttcccttttttgattggaaacacgaggcgcggcattatggaatt
gaagcacaggccacggtcgagcggctggcgtacctgagtgcccatgtgagtactaccgta
agtgatgttacggcgcgggaatgtgaggtttttctgggtaaatatcctgacttggtattg
cccaacggacttaatattcagcggtttgcggcagtgcacgagtttcagaatctgcacatg
aagtacaaggaaaatatccatcggtttatcatgggtcactttttccaaagctattcgttc
aatctggacaaaacgctttacttctttacctcgggtcgctatgaatttgtcaataaaggc
tatgacataacgatggaagccctggcgcgcctgaactggaaaatggtgcaggccaaaatg
gacatgaccgtcgtgatgtttatcgtgaccaagcagccgtatcattccatgaatccggac
gtgcttcaatcgcgggcggtattgggcgaaattcaggatacgtgcgaagccattgaaaag
caattgggcgataaattgtttttagcctctgcttcttcgaccgaccatcatttgccggat
ctgaaccaatttgtggacgaatattggcgacttcggcttcgtcgtaccattcaaacctgg
aaaacaaagcgtttgccgccgtacgtaacccacgatcttaagcaaccggattccattacc
gaatattgcgagcgctcgggcctgaaaaaccacgagcaggatcgtgtcaaaatcgtctac
caccctgactttattgcctccaccaatccccttttcggtttggattacggacagtttgtg
cgcggatgtcacttgggtattttcccaagttactacgagccgtggggatacacaccgctg
gagtgcgtagtgcgaggcattcccaccgtaacgagcgacctgtcgggttttggcgatttt
atcatgcagatcatgcgtgattatgaaaaccgaggcatttacgtgatcaatcgcaagacc
caaaactttgatcaggctgccgatcaactggccaatattatgttcaggtttgtacgaatg
aatctacgtgaacggattcagcagcgtaataaagtagaaaatatatcagacgtttttgat
tggggaaatctacgctcttactacgatacggcccacgatctggccgccaagaaagcgttt
aaaacaaaagtgaattaa

DBGET integrated database retrieval system