KEGG   Runella slithyformis: Runsl_2229Help
Entry
Runsl_2229        CDS       T01553                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rsi  Runella slithyformis
Pathway
rsi00010  Glycolysis / Gluconeogenesis
rsi00052  Galactose metabolism
rsi00500  Starch and sucrose metabolism
rsi00520  Amino sugar and nucleotide sugar metabolism
rsi00521  Streptomycin biosynthesis
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01120  Microbial metabolism in diverse environments
rsi01130  Biosynthesis of antibiotics
rsi01200  Carbon metabolism
Module
rsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rsi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Runsl_2229
   00052 Galactose metabolism
    Runsl_2229
   00500 Starch and sucrose metabolism
    Runsl_2229
   00520 Amino sugar and nucleotide sugar metabolism
    Runsl_2229
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Runsl_2229
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Runsl_2229
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Runsl_2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEI48641
UniProt: F8EFM1
Position
complement(2569321..2570229)
Genome map
AA seq 302 aa AA seqDB search
MEHYLGIDVGGTNVKMGVVDTETGRISNFYSHDTDSWRKSGHFEERLGDAIAIQLHEYPS
VKKIGIGLPGMINRNRTVPLEITAIPEIDNVPLVEYLSKRFSGVQFFLENDANAAALGEF
YFAEEKINENYIFITLGTGVGGAAIINRKVFVGGDGNAMEPGHIPSRNGKVLERNIGKKE
LLDLANDMRRTYTGETKLPEDGTISTTGLVAAAAEGDELALQVWTSVGEMLGDGLVSMVR
ILDIKLILIGGGLAASFDYIIPAVNKQLSYWLTPYYLKDLEIKRATLGNDAGLLGAASLC
FD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaacactatttgggtattgacgtgggcggaaccaacgtcaaaatgggtgtcgtggac
acagaaacgggacgaatttctaatttttacagtcacgataccgacagttggcgcaagtcg
ggacactttgaagaacgacttggcgatgccattgcgattcagttgcacgaatatccaagc
gtcaaaaaaataggaattggtttacccggaatgatcaatagaaatcggaccgttcctctg
gaaattaccgctattcccgaaattgacaatgttccgttggttgaatacctttccaaacga
ttttcaggtgtacagttctttctggaaaatgatgccaatgcggcagcattaggtgagttt
tattttgccgaagaaaaaattaacgagaattacatattcattaccctcggtaccggcgta
ggcggggcggcgatcattaatcgtaaggtatttgtgggaggcgacggcaatgccatggag
ccggggcatattccttctcgcaacggaaaggtactggaacgcaacatcggcaaaaaagag
ctgctcgacttggccaatgatatgcgccgtacctacaccggagaaactaaattgcccgaa
gacggtaccatttctaccaccgggctcgtagccgccgccgccgaaggcgacgaactggcc
cttcaggtatggacctccgtaggtgaaatgctgggcgatggactcgtgtctatggtacgg
attctggacattaaactgattcttatcgggggtggattggccgcttcgtttgattacatc
atccctgccgttaacaaacagctttcatattggctgaccccgtattatttaaaagacctt
gagatcaagcgtgccacgctgggcaacgacgccggcctgctgggagctgcctctttgtgt
tttgattaa

DBGET integrated database retrieval system