KEGG   Runella slithyformis: Runsl_2404Help
Entry
Runsl_2404        CDS       T01553                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rsi  Runella slithyformis
Pathway
rsi00480  Glutathione metabolism
rsi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Runsl_2404
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Runsl_2404
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Runsl_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AEI48814
UniProt: F8EAV1
Position
complement(2767818..2768399)
Genome map
AA seq 193 aa AA seqDB search
MATIKLLSVMLLSLISGLFADKKEIKTNTANAKPTASVYDYKMKALMGNEEISLSKYKGK
KIVLLNVASACGYTPQYADWQKFHEQYGDKIVVLGFPANNFGAQESGSNSEIAAFCQKNY
GVTFQMFSKIDVTGDNQHPLYRWLSTKSLNGWNDKAPSWNFCKYVVDENGKLTHFFASKI
KPTDDEFKKAVGI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatcaaattactttctgttatgcttttatccctcatttcaggcctttttgcc
gataaaaaagaaatcaaaaccaataccgcaaacgccaaaccgaccgcttctgtgtacgat
tataagatgaaagccctgatgggtaacgaagagatttcactgagcaaatacaaaggcaaa
aaaattgtgctcctcaacgtagcctctgcctgcggttatactccacagtatgcagattgg
caaaaatttcatgagcaatacggcgacaagatcgtggtactgggctttcccgccaacaac
ttcggtgcgcaggaatccggctccaattcagaaattgcggctttttgccaaaaaaattac
ggcgttacgttccaaatgttctccaaaatcgacgtaaccggcgacaatcaacacccactg
taccgctggctgtcgaccaaatcgctcaacggatggaacgacaaagccccttcctggaat
ttctgcaaatacgtggtagatgaaaacggtaaattgacgcatttctttgcctccaaaatc
aaacctaccgacgatgaattcaaaaaagccgtaggcatttaa

DBGET integrated database retrieval system