KEGG   Runella slithyformis: Runsl_4321Help
Entry
Runsl_4321        CDS       T01553                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rsi  Runella slithyformis
Pathway
rsi00071  Fatty acid degradation
rsi00280  Valine, leucine and isoleucine degradation
rsi00281  Geraniol degradation
rsi00310  Lysine degradation
rsi00360  Phenylalanine metabolism
rsi00362  Benzoate degradation
rsi00380  Tryptophan metabolism
rsi00410  beta-Alanine metabolism
rsi00627  Aminobenzoate degradation
rsi00640  Propanoate metabolism
rsi00650  Butanoate metabolism
rsi00903  Limonene and pinene degradation
rsi00930  Caprolactam degradation
rsi01100  Metabolic pathways
rsi01110  Biosynthesis of secondary metabolites
rsi01120  Microbial metabolism in diverse environments
rsi01130  Biosynthesis of antibiotics
rsi01212  Fatty acid metabolism
Module
rsi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Runsl_4321
   00650 Butanoate metabolism
    Runsl_4321
  Lipid metabolism
   00071 Fatty acid degradation
    Runsl_4321
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Runsl_4321
   00310 Lysine degradation
    Runsl_4321
   00360 Phenylalanine metabolism
    Runsl_4321
   00380 Tryptophan metabolism
    Runsl_4321
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Runsl_4321
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Runsl_4321
   00281 Geraniol degradation
    Runsl_4321
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Runsl_4321
   00627 Aminobenzoate degradation
    Runsl_4321
   00930 Caprolactam degradation
    Runsl_4321
Enzymes [BR:rsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Runsl_4321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF1033
Motif
Other DBs
NCBI-ProteinID: AEI50659
UniProt: F8EPY2
Position
complement(5007079..5007885)
Genome map
AA seq 268 aa AA seqDB search
MAFETFSLTIDNYIAGVTFNRPERANALNQKAWEEMKAIFEELDERDDVRVIILSGSGRH
FCAGIDLELLMQVAQSAQKCEGRKREKLRRQVLELQAPINAIEQCSKPVIAAIHGGCIGG
GVDIISACDMRYCTDDAFFTIKEIDMGMVADLGTLQRLPKIIAPGIAREMAYTGRQVAGR
EAERIGLANRSFADADTMQSEVLRIAQSIAAKSPLSIRGTKAILNHSRDHSVADGLDYMA
TWNAAMLLSNDLMEAFQAKMQKRDAVFL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaaaccttttccctgaccatcgataattacatcgccggcgtaaccttcaac
cgtccggagcgggccaacgctcttaatcaaaaagcctgggaggaaatgaaggctattttt
gaagaacttgacgaacgtgacgacgtcagagtcatcattttgagcggcagcggcaggcat
ttttgcgcgggcattgatctggagctcctgatgcaggtggcacaatcggcgcagaaatgt
gaaggacgaaaacgcgaaaagcttcgtcgacaggtgcttgagttacaggcaccgatcaat
gccattgagcagtgcagcaagcccgtcattgcggctatccacggcggatgcatcggcggg
ggcgtagacatcataagtgcctgcgacatgcgctactgtaccgacgacgccttttttacc
attaaagaaattgacatgggtatggtagccgatctgggtacgctccaacgcctgcctaag
atcattgccccgggcatagcgcgggaaatggcctatacgggacgacaggtagcgggccga
gaggccgaacgcatcggcctggccaaccgcagttttgccgatgccgacaccatgcagtcc
gaagtgctccgcattgcccaaagcattgccgccaaatctccgctttcgattcggggcacc
aaggccatcctgaaccacagtcgcgatcattccgttgccgacggcctcgactacatggcc
acctggaacgccgccatgctcctctccaacgacctcatggaagcctttcaggccaaaatg
cagaaacgtgacgctgtttttttgtaa

DBGET integrated database retrieval system