KEGG   Runella slithyformis: Runsl_5187
Entry
Runsl_5187        CDS       T01553                                 

Definition
(GenBank) signal peptide peptidase SppA, 67K type
  KO
K04773  protease IV [EC:3.4.21.-]
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rsi01002]
    Runsl_5187
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Runsl_5187
Peptidases and inhibitors [BR:rsi01002]
 Serine peptidases
  Family S49: protease IV family
   Runsl_5187
SSDB
Motif
Pfam: Peptidase_S49 CLP_protease ECH_1 SDH_sah
Other DBs
NCBI-ProteinID: AEI51487
Position
6029162..6030919
AA seq 585 aa
MWQFIKYVFATIVGLFLFSLLGFFLFIGLAAALGSSEEKTTVEKNSVLKLNLNSSIQEVS
VENPFAEFTGGQGEVIGLLDIKSALANAKLDPNIAGVYLDVQYPMVGWASAEEIRDAIID
FKKSKKFVYAYGEVMTEKAYYLASVADKIYLNPAGGMEWNGLSAEYDFYKGTLDKLEVKP
LVFRVGEYKSAVEPFFRENMSDASKLQNQVLINTIFGHAVENIAKSRNIPAAQLKNLADS
LSIDSPQDALKHKFITHIGYYDEVETSLKNELKLKEDDKIKFVTLGKYTKADKLVKEGPS
DRRIAVIVGEGAIMSGKSNDGNIGSETIMEELRKARKDKKVKAVVLRINSPGGSALASDV
MWREVQLTRKEKPVIASMSDVAASGGYYMAMGCDKIVAQPNTITGSIGVFSVLFNFEDTF
RNKLGITFDRVNTNAHSDWPSVTRDMTPFENNRLQKSTENIYAIFTRKAAEGRKMPLAKL
QALASGRVWSGKEAKANGLIDEFGGLDKAIQVAAQAAKLKEGDYRIKYPAEKNMFEQFIN
KLSGNAEEQLMQQKLGDFAPYLKVVKKLQQMQGTQARLPYDIVIK
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgtggcagttcattaaatacgtctttgcaaccatcgtaggtttgttccttttttcatta
ctgggattctttttattcatcgggttggcggcggcactcggctcctcagaagaaaaaacc
accgtagaaaaaaattcagttctcaagctgaatctcaacagttctattcaggaggtttcc
gtcgagaatccatttgctgaatttacgggcggccaaggcgaagtgatcggcctgcttgat
attaaatcggcccttgccaatgcaaaactggatcccaacattgcgggagtctatttggat
gttcaatatcccatggtaggctgggcatcggcagaagagattcgggatgcgatcattgac
ttcaaaaaatccaaaaagtttgtgtacgcctatggcgaagtcatgaccgaaaaagcatac
tatctggcctcggtagcggacaaaatatacctcaaccccgccggagggatggaatggaac
ggactcagtgccgaatatgatttttacaaaggaaccctcgacaaactcgaagtaaaaccg
ctggttttccgcgtaggagagtacaaaagtgcggttgagccgttcttccgcgaaaatatg
agtgacgccagcaagctgcagaatcaggttctgatcaatactatttttggtcatgccgtt
gaaaacattgccaaatcacgcaatattccggccgctcaactcaaaaatctggccgattca
ctgtccattgattcgcctcaggatgcccttaaacacaagttcatcacccatatcggctat
tacgacgaagtggaaacttccctgaagaatgaactcaaattaaaagaagacgataaaatc
aaatttgtgacgcttggtaaatacactaaggccgataagctcgttaaagaaggtccttct
gaccgtcgtatcgccgtgatcgtaggggaaggtgccatcatgtcgggcaaaagcaatgat
ggaaatatcggctctgaaaccatcatggaagagcttcgcaaggcccgcaaagataagaaa
gtgaaagcggttgttctccgcattaattctccgggcggcagtgccttggcatcagatgtg
atgtggcgcgaagtgcaactgacccgcaaagaaaaacctgtcattgcgtccatgtctgac
gtagcagcttccggcggttattacatggcgatgggttgtgataaaatcgtggctcagccc
aataccattacgggttccatcggtgtattcagcgttttgtttaacttcgaagataccttc
cgcaacaagttgggcatcaccttcgaccgggtcaataccaacgctcactcggattggccc
tccgtgacgcgcgacatgactccttttgagaacaatcgtctgcaaaaaagcaccgagaat
atttacgccatatttacccgcaaagcggccgaagggcgtaaaatgccgctggctaagctt
caggcattggcttcgggccgtgtatggtcggggaaagaagccaaagctaacgggttgatc
gatgaattcggtggattggacaaagccattcaggtagcagcccaagccgcaaaattgaaa
gaaggcgactaccgcataaaatatcctgccgagaaaaatatgtttgagcagtttatcaat
aaattatccggcaatgcagaggagcagttaatgcaacaaaaactgggcgattttgcgcct
tatctcaaagtcgtgaagaaattgcagcaaatgcagggcacgcaagcgcgtttgccgtac
gacattgtaatcaaataa

DBGET integrated database retrieval system