KEGG   Runella slithyformis: Runsl_5188
Entry
Runsl_5188        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DDE_Tnp_1 RANK_CRD_2
Other DBs
NCBI-ProteinID: AEI51488
Position
6031028..6032374
AA seq 448 aa
MFRTILQNKDKNASKSRASDFILERGHRYLHPLQLRLDALIDTRLVSTFYDLFMAILVFR
HNRMGLLLSELGGYICGLSHAPAGTKRISNLLRCKKWSSTLIDDFFFERSRERIKSLQSN
GQRPLLLWDESKIEKSESWFLEGLCSVESSKGKRLTKIRKGFYKPPTQRICVPGFHWTAT
LLSALGQTPSVCQMSWWTSRGKYQEVGTNIIFRMLKKLHKTIGSSVLHVLDRGYANAWTI
EWMNEFKQDFLVRWKKTHLLCHSEKGTKQTHLLARSFKAVGRKMLRDNQRKISKYVTIAY
TQVTHGDFKDKPLWLIIVRDKKSLQPPMYLLTSIAITNTRLAWEMCHSYMHRWNIEQTFR
CSKAELGMESPRLWFWENRLKLLAIVALVYDFLLMLLRNWSHWIPLFLRHWCHRTGNRYR
NASIPIYRLRLAISHVLYTACCACQTSG
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgttcagaacaatactgcaaaacaaggataaaaacgcttcaaagtcaagagcttcagac
ttcattttagaacgggggcatcggtatcttcacccacttcaacttcgcttagatgccctg
attgatactcgtttggtgagtacattctatgacttatttatggcgatattggtgtttcgt
cacaacaggatggggctgttattgagcgagttaggcgggtatatttgtggattatcgcac
gccccggcgggtacgaagcgtatcagcaatttacttcgatgtaaaaaatggtcttccaca
ttgattgatgactttttctttgaacgtagccgtgagcgaattaagtccttacaatccaat
ggtcaacgtcctttactgctgtgggatgagagtaagattgaaaagagtgaatcatggttt
ttggaaggcttatgcagtgtggaaagcagtaaaggcaaaagattgaccaaaataagaaaa
ggcttttataagccacctactcaacgcatttgtgtgcccggctttcattggacagctacc
cttttgtcagctttgggacaaactccaagtgtatgtcagatgagttggtggacatcaagg
ggtaaatatcaggaagtagggaccaacattatctttcggatgctcaaaaagctccataaa
accattggaagcagcgttctgcatgtgttagaccgaggttatgccaatgcctggacgatt
gaatggatgaatgagtttaaacaggactttttagttcgttggaagaaaacacatctatta
tgccattctgaaaaaggaaccaaacagactcatttattagctcgctctttcaaagcagtg
gggcgtaaaatgcttcgtgataaccaacgcaaaatcagtaagtatgtcactatcgcttac
acacaggtcactcatggtgattttaaagataaacctctatggctcattattgtacgtgac
aaaaaaagtttacagccccctatgtatctgctaacctccattgccattaccaatactcga
ttggcttgggagatgtgtcattcttatatgcatcgctggaatatagagcaaacctttaga
tgtagtaaagccgaattgggtatggagtcacccaggctttggttctgggaaaatagactc
aaattacttgctattgtagcattagtctatgattttctgctgatgttattgagaaattgg
agccattggattccgctttttctcagacattggtgccatagaacaggaaatcggtaccga
aacgcttcgataccgatttacagattaagactcgccatctcccacgtgctttacactgct
tgttgcgcttgccaaacttcgggatga

DBGET integrated database retrieval system