KEGG   Runella slithyformis: Runsl_5189
Entry
Runsl_5189        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: zf-ISL3
Other DBs
NCBI-ProteinID: AEI51489
Position
6032662..6032994
AA seq 110 aa
MESFLPIVQFLLPGFILENFELTTINRQEGVFHIHLTEKNTDDRDSERKNLLSKGFFAPI
TVQDFPLRGQKVFLHIKRRRWLNTQTGKVVYRDWAEVSKGTRMTSEFANF
NT seq 333 nt   +upstreamnt  +downstreamnt
ttggagagtttcctacctatcgttcagttcctgttgcccgggttcattttggaaaatttt
gaattgactactattaaccgccaagagggtgtcttccatatccatcttacagagaaaaat
acagacgatcgagactctgagcggaaaaatttgttatccaaaggtttttttgcgcccata
actgtccaagactttcccctgcgtgggcaaaaggtctttcttcacattaagcgccgccga
tggctcaatacccaaacaggtaaagtagtttacagagactgggcagaagtaagcaaagga
acgcgaatgacaagtgaattcgcgaatttttaa

DBGET integrated database retrieval system