KEGG   Runella slithyformis: Runsl_5192
Entry
Runsl_5192        CDS       T01553                                 

Definition
(GenBank) putative signal transduction histidine kinase
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: HATPase_c HisKA_3 HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: AEI51492
Position
6034406..6035668
AA seq 420 aa
MPFMRKPYLCYLIFFCFIYLVSDGRLSTVVAAKTVFALQSIQNFPASCRKNPFSHAGNSK
VFSASYCFFFMHLGALRGYFMNPALLFLLLFSRPSVNLKLSSPKSRLNFHSVQIAVRRWL
RPVWIYSFSVAFLLLFYAFTLFLVNTGHIELTFSGLIFFQVALTANMFIIIIGLTYLHWV
YENKHRKSQWKTRKQQKKLHDILQLKQQEEVRRIRLQQELQVQRERLARDLHDGIGSQLT
HIVTKLDMLSIRSAQARQLGLLSDFARETNQILRETIWVLNHDYIEYTQFQQRMSGFMNR
LWEDREQPELKISMSDHSSLLISPVVAMTIFRIGQEVINNALKYAEADCINIHFRQRSNT
VVVEINDNGTGFDLQKVKRGYGLDNIQKRCSELGGQLLLYSAPTGTTVMIELPPSEPKPL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgccgtttatgagaaaaccctacctttgttatctgatttttttctgttttatctacctt
gtcagtgatggccgattgtcgaccgttgtggctgccaaaactgtctttgccttgcaatcc
attcaaaattttccggcctcctgccgcaaaaaccccttttcccatgcgggcaatagtaag
gtcttttccgcttcttactgcttttttttcatgcacttgggggcattgagaggttatttt
atgaatccggcactgctctttctgctcctcttcagccgaccctccgtaaacctaaagttg
tcttcgccaaaatcacggctaaacttccattcggtacagattgccgtcaggcgttggttg
cgccccgtatggatctacagtttcagtgttgcttttttgttgttattttatgcttttacc
ctattcctggtgaatacgggccatatagaattgacattttcgggactgattttttttcaa
gttgccctcacagccaacatgttcattattattatcgggctgacgtatcttcattgggtg
tatgaaaataaacacagaaaatcacagtggaagacccggaaacagcaaaagaaattacat
gatattctgcaacttaagcaacaggaggaagtaagacgaatacgcctccaacaggaatta
caggtacagcgggagcgtctggcccgtgatctgcacgacggtatcggctcccaactcaca
catatcgttaccaaactcgacatgctatccattcgctcggcccaggcgcgtcagttgggt
ctgttgagtgattttgcccgagaaaccaatcagatactccgcgaaaccatttgggtcctt
aatcacgattatattgaatatacccaattccagcaacgcatgtccggttttatgaatcgc
ttatgggaagacagagaacaacccgaactcaaaatttcgatgagcgatcattcaagcctg
cttatttcccccgttgtggccatgaccattttcaggattggacaggaagtgatcaataac
gccttgaaatacgccgaggccgactgcattaacatccattttcgccaaagatccaatacg
gtagtggtcgaaataaatgacaacggcaccggctttgaccttcaaaaagtaaaacgcggg
tatggccttgacaatatccaaaaaagatgcagtgagctgggcggccaacttctgctttac
tcggcgcctacgggtacgacggtcatgatagaacttccgccttccgaaccaaaacccctt
taa

DBGET integrated database retrieval system