KEGG   Runella slithyformis: Runsl_5193
Entry
Runsl_5193        CDS       T01553                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 Sigma70_r4 HTH_40 HTH_30 HTH_38 DUF2089 HTH_29 HTH_11 HTH_5 HTH_DeoR HTH_Tnp_ISL3 Tail_P2_I HTH_24 DUF5052 HTH_20
Other DBs
NCBI-ProteinID: AEI51493
Position
6035750..6036391
AA seq 213 aa
MINVGLVEDNLLLAQGIKEKLALSDDLTLNFHVHDGKALFDYLEPDNLPEIILMDIEMDT
MDGITATRELKRRFPTIKVLMITVLDDDDKLFEAFKAGASGYLLKDVKPARLINAISETL
DGGIPMSPTIASKALDLLLQNDTSKQKNVTAQLSPRENDVLDLLVKGMSVRQISDTLFVS
EKTVRKHLEHIYQKLQVKGSREAIAKFVKRLVK
NT seq 642 nt   +upstreamnt  +downstreamnt
atgataaacgtgggattagtggaggataatcttcttctggcacaggggataaaagaaaaa
ttggcattaagcgacgatctgacgttaaactttcacgtacacgatggaaaagcacttttt
gattacttagagcccgacaacctgccggaaattatcctgatggatattgagatggataca
atggatggaatcacggcaacccgcgaattgaaacgtcgttttcccaccatcaaagtactg
atgattacggtcttagacgatgatgacaaactgtttgaagcctttaaagccggtgcctcc
gggtatttgctcaaagacgtaaaaccggcccggttgatcaacgccatttccgaaaccctc
gatgggggcattcccatgtcgccgacgatcgcctccaaagccctggatctcttactgcaa
aacgatacttcaaagcaaaaaaatgtaacggcgcagttgtcgccccgtgaaaatgacgta
ctggacttattggtaaaaggaatgagtgtgcgacaaatcagcgatacgctgtttgtatcc
gaaaaaaccgtacgcaaacatttggagcatatttaccaaaagttgcaggtaaaaggcagt
cgggaagccattgctaaatttgtaaaaaggttagtcaaataa

DBGET integrated database retrieval system