KEGG   Runella slithyformis: Runsl_5194
Entry
Runsl_5194        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Pesticin TFR_dimer
Other DBs
NCBI-ProteinID: AEI51494
Position
complement(6036401..6037156)
AA seq 251 aa
MIRYEFTYNQEIGHQGQSLVPHFPGGNSGVTIGPGYDMGRRSPGEIYADLTRVGVHPEVA
EMLSRAAYKTGDEARQWISRHGGLYITEEQQQALYEEVLVPEYEQRMQLQLRHLAENCEG
ITDEMADLEHLSARQKHILFDYTYNAGLSKFPTLVEAVLKEDWDEVSRHYERFSAGEPLY
YRNELFYQTFLDPVTAVQFEHEEEINPEMMAIEGMLEDIADDNTPENERLHGREADYQAP
DVDQLLNDSHW
NT seq 756 nt   +upstreamnt  +downstreamnt
atgatacgttacgagtttacttacaatcaggagattggccatcagggacaaagcctcgtg
cctcattttcccggcggaaactccggcgtgaccatcggcccgggctatgacatgggcaga
cgcagccccggtgagatctatgcagaccttacgcgggtaggcgtacatccggaagtggcc
gaaatgctctcccgggctgcgtataagacgggcgatgaggcccgacagtggatcagccgg
cacggtggcctgtacattacggaagagcagcaacaggcactctatgaagaggtattggtt
cccgaatacgagcagcgcatgcagcttcagcttcgtcatttggcagaaaactgcgaagga
atcaccgatgaaatggcggacttggagcatctgtcagcccgtcaaaaacacatcctgttt
gattatacctacaacgccggtctcagtaagtttcccacgctggtagaagcggtgttgaaa
gaagactgggatgaggtaagccggcattacgaacggttttcggccggggagccgctgtat
tatcgaaacgaattgttttaccaaacattcttagatcccgtaaccgccgtgcagtttgag
catgaggaagaaataaatcccgaaatgatggctattgaagggatgctggaggatattgcc
gatgacaatacgcccgagaatgagcgcctgcatgggcgggaagccgactatcaggcacct
gatgtggatcagctcctgaacgattcacattggtaa

DBGET integrated database retrieval system