KEGG   Runella slithyformis: Runsl_5196
Entry
Runsl_5196        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51496
Position
complement(6038699..6039502)
AA seq 267 aa
MKKILLLGIGVWWLALAEAMAQPRISGVRFEVNSKDKLIEITYDVFGIRMADSIYVTVAG
KTSGNIVPRSLSGAVGRGVKPGSGRKIYWDVVADGLKIDEEIEVKVQLELAEAYALAGRD
TTGRPPKTVVKRDRKGLNGGALLVLGGGLAAGGGLYYWSTLMKEKSIASYDLYKIRNWNH
KQDISIGTDTELQRRLAASIEQSDADFKKAKTQQTLSKVMLIGGVALAVTDAFFTIPTLL
QKKNNRVGLRFDMSPWGVASAGVNVKF
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaagaagattcttctgttgggtatcggggtgtggtggttggcactggcggaagccatg
gcgcagccccgtatcagcggtgttcggtttgaggtcaactcaaaagacaagctcattgag
atcacctatgatgtattcgggatcaggatggccgactctatctatgtaacggtggccgga
aagacttccgggaatattgttccccgctccctgagcggagctgtgggccggggcgtaaaa
cccggctccggccgaaagatctattgggatgtggtggccgacggccttaaaattgatgaa
gaaattgaagtaaaagtacagttagagctggcagaggcctatgccttggcgggacgtgat
accaccgggcgtccgcctaaaacggtcgttaaaagagaccgaaaagggctcaacggcggc
gccctgttggtattgggtggtggcttggcggcgggcggcgggctgtattactggagtacg
ctgatgaaagaaaaaagcattgcctcctatgacctctataagatccgtaactggaaccat
aagcaggatatatccataggaaccgataccgagttgcagcgccggctggcggcttcgatc
gaacagtccgatgctgattttaagaaggccaaaacgcagcaaacgctctcgaaagtcatg
ctgatcggcggggtcgcccttgccgttaccgacgctttttttaccattcccacccttctt
caaaagaaaaacaatcgggtagggcttcgcttcgacatgagcccttggggagtggcctcc
gccggggtaaacgttaaattttaa

DBGET integrated database retrieval system