KEGG   Runella slithyformis: Runsl_5197
Entry
Runsl_5197        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51497
Position
complement(6039509..6039880)
AA seq 123 aa
MERGRTDTLRGIYKLLILWGLVLLMGCETFQKVDFQEERCRQAPAGTIAAAKGENLRWEF
SLTGISNTVETEPIRVVWTIEGKAFAAQRVSYQFDKRGEQKITVVLTNRCLMQTTRETTI
TVN
NT seq 372 nt   +upstreamnt  +downstreamnt
atggaacggggccgaaccgatacgttgaggggtatttataagttgttgattctttggggc
ttggttctgttgatgggctgcgagacatttcagaaagtggattttcaggaagagcgctgc
cggcaggctccggcgggtacgatagcggcggctaaaggtgaaaacctgcgctgggagttt
tccctgacgggcatcagcaacaccgtagagaccgagcctatccgcgtggtgtggaccatt
gagggtaaagcctttgccgcgcagcgggtatcgtatcagtttgataaacggggtgaacaa
aaaataaccgtcgtgctgaccaaccggtgtttgatgcagacaacgcgggaaacgaccata
acggtaaattga

DBGET integrated database retrieval system