KEGG   Runella slithyformis: Runsl_5198
Entry
Runsl_5198        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51498
Position
6040009..6040101
AA seq 30 aa
MVSWPCTRFETRGYDENIYDEVIFNKINGI
NT seq 93 nt   +upstreamnt  +downstreamnt
atggtgagttggccctgtactcgctttgaaacacgcggttatgatgagaatatttacgat
gaagttatttttaataaaattaatggtatttag

DBGET integrated database retrieval system