KEGG   Runella slithyformis: Runsl_5199
Entry
Runsl_5199        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Ig_7 Por_Secre_tail
Other DBs
NCBI-ProteinID: AEI51499
Position
6040091..6043687
AA seq 1198 aa
MVFSLIQFWSYTSQAGYYYYNGNPSASFNFNSQNCRNTFTISNVEIRINNRSEAYIKIIG
SLNVSIGNGSVTYESYGSISGGNVNFATTNSSTGYHWCTSDIASNRTFWRASISNLNFTG
GQNISCTLTVSTVGLAPASSDPKNILLSFIDSGSPSFVQSTSGITGTSVCAGTTLSLTIR
GSAPTRAVVVANVGGVQTQIGTVTSDNDFDTWGTINWTVPAGIASGTQIFFRVNALSVTQ
SSAFSAFSPVSPNLIISETSLCSAKQIALQVTGISGNLFVDGNNGWPSNSTTYNPTPQSS
TTYTVTVQRRGNGSDRVCSPVTVSQSVQVFTFNPSIATASQTKCLGEAISVRAEPNGNGS
FDYTWTRDGQGAGNGQQIEAREPGNYSVSIKPTGAAASCPAKSAGPVRFNFDTPIPDQNI
TFPKERPIICGAPDPTTLTLTAQPGQSGINYQWQREGGGFNANGQSVTVSQSGKYIVNMN
RGACSRQKSIEVQDNNYDPNIASAPDAFCSDAPITLTANANDPGRFDYAWKREGTGFGGN
SPTLTLPNELGTFRYKVEITSKGTGCSTKTSAEIVIRADRAITGHKIILPAGKMRAVICG
APEEPAIDLSAAADAPLEGITYQWQGPAVTGTAAVGKVSREGDYRVIFRRGACSKESTVK
VESGFFVPNISSTGTIINSPTDIRICSGESSIISASLDGTGIPNNTANFTYQWFGGVEGN
TELTTQKDNTLRVSTPGLYRLEVALTGSGCAVRKTAQKIKITVDPAFKNARITPNPAIIC
NKATGLEIAVLSDSSAGATYRWSGGGKSNSDPSKYVVDNAGTYTAFLSRGACFAQANVSP
REEELKVTVTPPNQSNPIIVCSGANGIPMVLQAVSNLSSAVITWKRDDSDAPGSNTGTGY
TPTQTGRYFATANFNNICTATSPQRIAVEALSNFSVNITPNNPPALCDDRPIPLTATVSD
TRYTALYNYEWIQDTRSVKTGIGANTLSTGKVVNYTGNTLVLGNESNYTLSIVKDGCKAT
SSVSKITLKPARSGIIVLDYNTLQATESSDGTYQWYYKPGNAASLADSAGYTLEAGVTGR
MLLGAKPGSYMVRANRNGCGTKYSFAYSVAVATAIDPLLNDEWKVYPNPTTEAITVENRA
GSAIPATLDIWNANGQKLRSHRQLNARESYPLTDLPMGTYYLEIRQNGQKVTKKIIKE
NT seq 3597 nt   +upstreamnt  +downstreamnt
atggtatttagtttgattcaattttggagttatacttcacaggcaggatattattattat
aatggaaacccatctgcttcattcaattttaactcacaaaactgtagaaatacttttacc
atttctaatgttgagattcgcataaataatagaagcgaagcatatattaaaattatcgga
agtttaaacgtaagtataggaaacggaagtgtaacatatgaaagttacggttcaatatca
ggcggaaacgttaattttgcaacaacaaattcatccacaggttatcactggtgcacatct
gatattgcatcaaatcgtactttttggcgcgcttctatcagtaatttaaattttaccggt
ggacaaaatatcagttgtactttaacagtatctacagtagggcttgcacctgcctcatcc
gacccaaaaaatattttgttatcttttattgattccggctctccttctttcgttcaaagc
acaagcggcatcaccggcacctccgtttgcgccggtacaaccctatcgctcaccattcgg
ggcagtgctcccacaagggccgtagtggtggcaaatgtcgggggggtacagacacagatt
ggtacggttacctcagataatgattttgatacgtgggggaccattaattggactgttccg
gcaggaattgcaagcggtacgcaaattttctttagggttaacgctttatcagtgactcaa
tcttctgctttttctgcgttcagccccgtgagccccaacttaatcatcagtgaaacctca
ctttgcagcgcaaaacaaattgctttacaggtaacgggaatcagcggaaacctctttgtg
gatggcaataatggctggccttccaacagtaccacctataatcccaccccacaaagcagt
acaacgtataccgtaactgtacaacgaagaggaaacggaagtgacagagtttgttcacct
gtcactgtcagtcaatccgttcaggtcttcacgttcaatccatctatcgccaccgcctct
caaaccaaatgtttgggtgaggccatcagtgtaagggccgaacctaatgggaatggatca
tttgactatacatggacccgcgacgggcagggagccggcaacggacaacaaattgaggcc
cgagaaccgggaaattacagcgtcagcatcaagcctacgggcgctgccgcgtcctgtccg
gcgaaaagtgccggcccggtccgctttaactttgatacccccattcccgatcagaacata
accttccccaaagagcggcccatcatttgcggtgctccggatccgacgaccctcaccctt
acggcccaacccggacaaagcggcatcaattatcaatggcaacgcgaaggcggcggattc
aatgccaacggtcagtccgtcacggtcagtcaatcgggcaaatacattgtcaatatgaat
cgcggagcctgtagccggcaaaaatccattgaagtgcaggacaacaactacgaccccaat
attgcttctgcgcccgatgccttctgttctgacgcccccattacacttacagccaatgcc
aacgacccgggccgctttgattacgcctggaagcgcgaaggaacaggttttggcggcaat
tcccctaccctcacccttcccaatgaacttggtacgtttaggtataaggtggaaatcacg
tccaaagggacgggctgcagcacaaaaacatccgccgaaatagtcatcagggcagaccgg
gccatcaccggtcacaaaataattttgcctgccggtaaaatgcgcgccgtcatttgcggt
gcgcccgaagaaccggccattgacctgtcggccgccgccgatgccccccttgagggaatt
acgtaccaatggcagggacctgccgttacgggcacggccgccgtgggaaaagtcagccgg
gagggtgactaccgggttatcttccggcggggcgcgtgcagtaaagaatcaacggtaaaa
gtggaatccggtttttttgtgcccaacatcagttctaccggcacgatcatcaactctccc
acggatatccgcatttgcagcggcgaatcttcgatcatttcggcttccttggacgggacc
ggcattcccaacaacacagctaattttacctaccaatggtttggcggggtggaaggcaat
acagagctgaccacccaaaaggacaataccctgcgcgtttccactccggggctctatcgg
ttggaggtggctctgaccggcagtggctgcgccgtaagaaagaccgctcagaaaatcaaa
attaccgttgaccccgcctttaaaaacgcccggatcacccctaatccggccatcatctgc
aataaagccacgggtctggaaattgccgttctcagcgacagcagcgccggagccacctac
cgttggagcggcggcggcaagtccaacagtgatccgtccaaatacgtggtagacaatgcc
ggtacctatacggcctttctttcgcgcggggcctgttttgcgcaggcgaacgtcagcccg
cgcgaagaggaactgaaagtaacggtaacccctcccaaccagtccaatcccatcatcgta
tgcagcggagccaacggcatcccgatggtattgcaggccgtctccaatttaagttcggcc
gtcattacctggaaacgtgacgacagtgatgccccgggcagcaataccggtaccggttat
acccctacccaaacgggacgctactttgccactgccaatttcaataatatctgtacggct
acttctccgcaacgaattgcggttgaagccctcagcaatttcagcgtcaatatcacgccc
aacaaccctccggcactctgtgatgaccgccccattccgctcacggccacggtttcggat
acgcgctatacggcattgtacaactacgaatggattcaggatacgcgctcggtaaaaaca
ggcatcggagccaataccctcagcaccggaaaagtggtgaattatacgggcaatacgttg
gtattgggcaatgagtctaactataccctcagcattgtcaaggatggctgtaaagccact
tcctccgtcagtaaaatcaccctcaaaccggcacggtccggcattattgttctggattat
aacacgttgcaggccaccgaaagcagtgacggtacctaccaatggtactataaaccggga
aatgccgcttcacttgccgattcggcgggctacactttagaagcaggggtcacgggccga
atgctgttgggggccaaaccgggaagctacatggtacgtgccaaccgaaacggctgcggc
actaaatattcatttgcctattccgtagcagtagctacggccattgatcctctgctcaat
gacgaatggaaggtataccccaatccaacgaccgaggccatcacggtggaaaacagagca
gggtcagccattccggccacccttgacatttggaatgccaacgggcaaaaattacggagt
caccgacagctgaacgcacgggaaagctacccgttaaccgatctgcccatgggaacatat
tacttggaaatcaggcagaacgggcagaaagtcactaaaaagattatcaaagaatga

DBGET integrated database retrieval system