KEGG   Runella slithyformis: Runsl_5200
Entry
Runsl_5200        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51500
Position
6043684..6045468
AA seq 594 aa
MRRYLYTLIVPLLLFSFSVRSQEKVKTLVATSAWKRINTLPLFETEAEKPIAKEKNESRA
TDTADTQPTDIAANTSVPEKAPESDAKRSRRTKKTKAGASEAIAEQTAAADLKDKKNTFL
PPADAPADAEVEENEPTTVSKRKKREKKPKETQDFARAETKPAAESLTPESAVKPKKKAP
EPKPKADNTVTENTLSFQQVEGVKADLKPLESVEVMYFSKQNRYTKRENAYFYRKGQFDP
RTRQPKGMVQDFYAGTDKPKFKGQYERYNNDDESNNNKYDGTCEFYSEDGAKSIRIYSKG
RLTQEARFNKAGQPTAEAQYNFDGKRKNFKEFLFDENGTQIGTLIGGYDSNSGLEKATQQ
LFQNGKFHSAIEFIGGCPKNEAKFMDEDGTEYRAFFQDFTCEPDNLWKFTNSSNFEVTHR
KPEKAYSIRSLQSQTGFLHLPVTHDFYKKSFEIEAVFDVTGQRSMTEFGIVWEYQDPQNY
SYFTIDPVKQVYEINAVKEGTVRKYMTGINPQKLDLSEPQIKINYRKTGSEIFYTVNGQP
LRFTTTRNTGLQTFNKSARVDLEKEYKTWNIGFLFKSQAPNESILLKGLKIKLK
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgagacgatacctttacaccctcatcgtaccccttcttcttttcagcttctctgtccgg
agtcaggaaaaggtgaagaccttagtggcaacaagtgcgtggaaaaggatcaacaccttg
ccgctgtttgagaccgaagccgaaaaaccgattgccaaagaaaagaacgaaagtcgggct
accgataccgctgatactcaacccactgacattgcggccaacacctctgtaccggagaag
gctcccgaatcggacgccaaacgaagcaggcgaactaaaaaaaccaaagcgggagcatct
gaggccattgccgaacagacggccgcagccgatctaaaggataaaaaaaataccttcctt
cctcccgccgacgctcctgccgatgctgaggtcgaagaaaatgagccgacaaccgtttcc
aaacgaaaaaaaagggagaaaaaaccaaaggaaacccaagacttcgcccgggccgaaacc
aaacccgcggcggaatcgcttacgcctgagtcggccgtaaaaccgaagaaaaaagccccg
gaacctaaaccgaaagccgataataccgtcacggaaaataccctttcttttcaacaggtg
gagggcgtaaaagcggatctgaaacctttggaaagcgtggaagtgatgtatttcagcaaa
caaaaccgctacaccaagcgtgaaaatgcctatttctaccgaaaagggcagtttgacccc
cgtacccgccaacccaaagggatggtacaggatttttatgccggcaccgataaacccaaa
tttaaaggtcagtacgaacggtataacaacgacgatgaatccaataacaacaaatacgac
ggtacctgcgaattttacagcgaagacggcgcaaaaagcattcgtatctacagcaaaggg
cgcttaacgcaggaagcccgattcaataaagcaggtcaaccgaccgccgaggctcagtat
aattttgacggtaaacgcaaaaacttcaaagagtttctcttcgatgagaacggaacccag
atcggtacgctgatcggaggctatgactccaattcgggattggaaaaagcgactcagcaa
ctattccaaaatggaaaatttcattcggccattgaattcatagggggctgtcctaaaaac
gaagccaaatttatggacgaagacggcaccgaatacagggctttcttccaggattttacc
tgcgagcccgacaatctatggaaatttaccaacagcagcaattttgaagtgacccaccgg
aaaccggagaaagcctattccatccgaagtctgcaatcgcaaaccggctttttacacctc
cccgttacccacgatttttataagaaatcatttgagatcgaggctgtttttgacgtaacc
ggccaacgctccatgaccgagtttggcattgtttgggaataccaggacccccaaaactat
tcttattttaccatcgaccccgtcaaacaggtatacgaaataaatgccgtcaaagagggc
acggtcagaaagtatatgaccggaatcaacccccaaaaactggatctctcagagccgcag
atcaaaatcaattaccgtaaaacaggcagtgaaatattctataccgtcaacggccaaccg
ctcagatttaccacgacccgaaataccggtttgcagactttcaataaatcagcccgggtc
gatctcgaaaaagaatacaaaacctggaacatcggcttcctttttaaatcgcaggcgccc
aatgaatccatccttttaaaagggttgaaaatcaaactcaaatag

DBGET integrated database retrieval system