KEGG   Runella slithyformis: Runsl_5201
Entry
Runsl_5201        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
  KO
K03641  TolB protein
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsi02000]
    Runsl_5201
Transporters [BR:rsi02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Runsl_5201
SSDB
Motif
Pfam: PD40 DPPIV_N DUF4988
Other DBs
NCBI-ProteinID: AEI51501
Position
6045530..6046507
AA seq 325 aa
MKKFFLLVLVTATLGACAPKAFQMTSEGENFDALTQISDSEKPCLYPFGGDLGENLVYVS
REDDGSYNLYMKEKVLTKAVIQKTSGKNINLAPNYCNANNRIVFQYFDKTNFDIYYIDAG
KGKAITQVTNTDDDEYNPSWSPDGNIIVFEKGATPKTYAVASQKSSKVYDGVAVKKNQIW
LKDLKSKELKMIGEGSFPKISPDGKNITFVKYDLDKSKSKETGTLWIMSLEGDSPRQITD
VNLGYATNPNWSPDGKNLIFQLTKKNKTDADIYVIDVNGENLRQYTVNKSNDFAPYWSVD
DYIYFSSDRGAKASKYQIWRFKMKK
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaaaaagttttttttactcgttttggtgaccgctacgttgggagcatgtgctcctaag
gcctttcaaatgacctctgaaggtgaaaactttgacgcactcacccagatcagcgactcc
gaaaaaccctgtttatatccttttggcggcgatctgggcgaaaacctggtctacgtctcc
cgcgaagatgacggctcttacaatctgtacatgaaagaaaaggtactgacaaaagccgtg
atccaaaaaacaagcggcaagaatataaacctcgcccccaactactgcaacgccaacaac
cgtatcgtgtttcaatattttgacaaaacaaattttgacatttattacatcgacgccggc
aaaggcaaagccatcacgcaggtgaccaataccgacgatgatgagtacaacccttcctgg
tcgccggatggcaacatcatcgtctttgaaaaaggagccactcccaaaacctacgccgta
gcttcccaaaaatcatccaaagtctatgatggtgtggcggtgaaaaaaaatcaaatttgg
ctgaaagacctgaagagtaaagagctgaaaatgatcggcgaaggcagcttccccaaaatc
tcgcccgacggcaaaaacatcacttttgtgaaatacgatctggacaagagtaagtccaaa
gaaaccggcaccctctggatcatgtcactggaaggcgactcgccccgtcagatcacggat
gtaaatcttggatatgccaccaaccccaattggagcccggatggcaaaaacctgattttc
caattgaccaagaaaaacaaaacagatgccgatatctacgtgattgatgtcaacggcgaa
aacctgcgtcaatataccgtcaacaaatccaatgattttgcgccttactggtcggtggac
gattacatttatttcagttcagaccggggagccaaagcttccaagtaccagatttggcgc
tttaaaatgaaaaaataa

DBGET integrated database retrieval system