KEGG   Runella slithyformis: Runsl_5202
Entry
Runsl_5202        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Mad3_BUB1_I_2 MCR_C Sec34 SLX9
Other DBs
NCBI-ProteinID: AEI51502
Position
6046540..6047679
AA seq 379 aa
MKHLYIFWLSLLSAGTSIAQSREYLYWVTGNKVEGRIVSVEDEDKVKTMLENGSIFYGGR
DKILIAFNKAGSFLVVKDISTDANQAQRQIEAFYKETEAPKNANDILLKAIPREVIACTI
KNELESAVNYLTADGNSASINKDNLFAIIRRDGSHEVLRDITEVVDNLSSMSADFHRLRE
QKKVVEPPKPKPVTPSPKPVIAGPAEPEQKPVLKDKKHLTPEEQRTYKAKSVEKMEELAD
LLNEIVDKKRSRDEKDEAIKKAVKMFTKEAKVEVSSLNNPNSKTNRPVAEYLDRLSRLNY
SNVKITYGEIKFVEEFERDDQNNYWGMTSYSQTFISDNYSDVTPKRQKIKLQRYEKTIDG
VTSDHFNVLLGNISVDVKP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaaacacttatatatcttttggctaagtttattgagcgcaggtacctctattgcccaa
agtcgggaatacctgtattgggtcaccggcaataaagtggaaggccggatcgtatcggta
gaagacgaggataaagtaaagaccatgctcgaaaacggctctattttttatggcgggcgt
gataaaatcttaattgccttcaataaagcgggaagttttctggtggtcaaggatatttca
acggatgccaaccaggctcaacgccagatcgaagctttttataaagaaacggaagccccc
aaaaacgccaatgatattctgttgaaggccattccccgggaggtgatcgcgtgcaccatt
aaaaatgaattggaaagcgccgttaactacctcaccgctgacggcaattcggcctccatc
aacaaagacaacctgtttgccatcatccgccgtgacggttcgcatgaagtactgcgggat
attacggaggtggtagacaacctgtcttccatgtcggctgattttcaccgcttacgcgaa
cagaaaaaagttgtcgaacctccaaaacctaaacccgtaaccccgtctcccaaacccgtt
attgcgggtccggcagaaccggagcagaagcccgtcctgaaagataaaaagcacctcacc
ccggaagaacagcgaacgtacaaggcaaaatcggtggaaaagatggaagagcttgccgac
ctgctcaacgagatcgtcgataaaaagcgcagccgggacgaaaaagatgaggccatcaaa
aaggccgtcaaaatgttcaccaaagaggcaaaggtggaggtaagttccctcaacaacccc
aacagcaaaaccaaccggcccgtcgccgaatacctcgaccggttgagccggctcaattat
tcaaacgtgaaaattacctacggcgaaataaaattcgtcgaagaattcgagcgcgatgac
caaaacaactactgggggatgacctcctactcgcagacgttcatcagcgacaattacagt
gacgtaacccctaaacgtcagaagatcaaactccaacggtatgaaaaaaccattgacggc
gtaacgagcgatcactttaacgttttgcttggcaatatttctgtggacgtaaaaccttaa

DBGET integrated database retrieval system