KEGG   Runella slithyformis: Runsl_5203
Entry
Runsl_5203        CDS       T01553                                 

Definition
(GenBank) OmpA/MotB domain protein
  KO
K16191  peptidoglycan-binding protein ArfA
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsi02000]
    Runsl_5203
Transporters [BR:rsi02000]
 Other transporters
  Pores ion channels [TC:1]
   Runsl_5203
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: AEI51503
Position
6047679..6048998
AA seq 439 aa
MEHMSRTFLFGLLCILSRVGWGQCITLKGTIKEAVSGPAVQANFSVRMNGTKQAVGKSTE
QGTFSLLLPCSATALMVEKKGFRTLVIPITGNEGTAAFFVDLELYPVDKQTADRPYFQSE
QQDLVLAGKDSTRSDRYAVRYFKLIDEQTKLPLKGEVCLLYTKTDVKKCLPISNSTKGEK
VVFTQEDIVGVIVTVNGYQTYNGNLIIDRLDNQSSVYEIALSRMVSMIAFSINASNATPN
STVKLVDVGNKPVPLRMADETHGYARVTTGSDYRLGWYSGSLKKTAERVITQVKGLHLVS
LTVTEPSPLPAARPPLSGTVAIPAARTILFSQSQYELSLSARQTLDSVAYWLKQNPEMKA
QITGFTDNVGNPGLNKTLSEFRAKVTIHYLTARGVPDDRLVGRGLGDQSPAAPNDTEANK
VRNRRVEIKLLPDSFTGLK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggagcacatgtcgaggacttttcttttcggtctgctgtgtatcctctcacgcgtgggt
tgggggcaatgcattacgctgaaaggaaccataaaagaggccgtatccggtccggcagtg
caggcaaatttttcagtacgaatgaacggcaccaaacaggctgtcgggaaaagtaccgag
cagggtacgttctccctgttgctgccctgctccgctactgctctgatggtggaaaaaaaa
gggtttcgcacgttggtgattcccattaccggcaatgaaggaaccgccgcatttttcgtg
gatctggaattgtatccggtggataaacagaccgctgaccggccttactttcaatccgaa
cagcaggatctggtactggccggaaaagactccacccgctcagacaggtatgccgtacgg
tattttaagttgatagacgagcaaacgaaacttccgcttaaaggagaggtttgtctgctg
tataccaagaccgatgtaaaaaaatgcctgccgatcagcaactcgaccaagggagagaaa
gtcgtttttacgcaggaagacattgtaggagtgatcgtcacggtcaacggataccaaacc
tacaacggcaatttgatcattgaccgcctcgacaaccaaagctcggtctacgagattgca
ttgagcagaatggtctccatgattgccttttccatcaacgcctcaaacgcaacgcctaat
tcgacggtcaaactggtggatgtcggcaacaaacccgttcccctacgcatggctgatgaa
acccacggatatgccagggtgaccaccgggagcgattaccgacttgggtggtattcgggt
tcactgaaaaagaccgcagagcgggtcattacacaggtcaaaggcttgcatttggtttca
ttaaccgtcaccgagccgtcccctctcccggccgcccggcctccgctttccggtacggtg
gctattccggccgcccgcaccattcttttttcgcagagtcagtatgaactttcgctttct
gcccgacaaaccctggattcggtggcgtattggctgaaacaaaatcctgaaatgaaagcg
cagatcaccggatttacggacaatgtaggcaaccccgggttgaacaaaacactttctgaa
tttcgggccaaagtcaccattcattatctgaccgcccggggagtgccggatgatcggttg
gtcggtcggggtttgggtgatcaatctcccgccgctcccaacgatacggaagcaaacaaa
gtgcggaacaggcgtgtagaaataaaactgctgcctgactccttcacagggttaaaataa

DBGET integrated database retrieval system