KEGG   Runella slithyformis: Runsl_5205
Entry
Runsl_5205        CDS       T01553                                 

Definition
(GenBank) peptidase C14 caspase catalytic subunit p20
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Peptidase_C14 Peptidase_C13 DUF218 EF-hand_6
Other DBs
NCBI-ProteinID: AEI51505
Position
complement(6050078..6050953)
AA seq 291 aa
MNVKNNPPTLYNGRRASQALKQPLPSMNAYFSKTFILTALTFLGLFAAGRAQTTYAVVVG
ISNYQKFQPGKGDLIFAGRDAELFYRYLTDPRGRNVPRKNVVLLTEAQATKTNILKALEL
FAEAKPEDQVIFFFSGHGNAGVFLPYESSGIKPLLTHEEVKLAFRKSHARLKLCLADACK
SGTLEIQSLPPSESLQELSNTNIIVFLSSLSNQLSVEYGRLGQGVFTYYLLKALRGEADR
DNDKSITAFELYQYVSRNVRNYSKQFNPEHTEQIPTMYGKFPKDLPLAAYP
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaacgtgaaaaacaacccgccgaccctatataacggaaggcgagcctcacaggcattg
aaacaaccgctaccctccatgaatgcatatttttcaaagacgttcattctgactgcactg
acttttttgggcctttttgctgccggcagggcgcagactacctacgcagtggtggtcggt
atttccaactatcaaaaattccaacccggtaagggcgatctgatttttgccggccgggat
gcggaattattttatcgctacctgaccgatccgcgggggaggaatgtgccccggaaaaat
gttgttttattgaccgaggcacaagcaaccaaaaccaatattctgaaagccctggagttg
tttgccgaagccaaaccggaagatcaggtcatttttttcttttcaggccacggaaatgca
ggggtatttttgccctacgagagcagcgggatcaaacccctgctgacccacgaagaggta
aaactggcgtttcggaaatcacacgcccgcctgaagctgtgcctggcagacgcctgcaaa
tccggtacgctggagattcagagtttaccgccgagtgagagtctgcaggagttgtccaac
accaatatcattgtgtttttatcttctctttccaatcagctttcggttgaatacggccga
ttggggcagggggtctttacgtattatctgttgaaggcgctgcgcggtgaagccgatcgg
gacaacgataaatccattacggcgtttgaactgtatcaatacgtaagtcggaatgtgcgc
aactactcgaagcagttcaacccggaacatacggaacaaattcccaccatgtacggcaag
tttcccaaagacttaccgctggcagcctatccctga

DBGET integrated database retrieval system