KEGG   Runella slithyformis: Runsl_5207
Entry
Runsl_5207        CDS       T01553                                 

Definition
(GenBank) Forkhead-associated protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: FHA Yop-YscD_cpl Ribosomal_S27e DNA_RNApol_7kD DZR Baculo_ME53
Other DBs
NCBI-ProteinID: AEI51507
Position
complement(6052517..6053215)
AA seq 232 aa
MEITCKKCKSRLKIINTGSPIVKCGNCGYPNPVVISPPKAGETNAPPAPATAKVAPPPSP
FPPPNPNPRPFVGGGLPHTPGAAPKSEPGWLVVHDENAPEQTHSLRVGRQVIGRLNTTAP
CDIMITTQDVYMSRNHCILEVKPGRTGGFDYLLSDRKMTNGAPELMSANGTYVNAFEKPL
QPNDMVYLNDGDTIQIGQTKVVIKTIKTVANADDATRLVRDTDYTPTVIIKN
NT seq 699 nt   +upstreamnt  +downstreamnt
atggagattacctgtaaaaagtgtaaatcacggcttaagattatcaacaccggcagtccg
attgttaaatgcggcaattgcgggtatcctaatccggtcgttatcagccctccgaaagcg
ggagaaacaaatgcgccgccggcaccggctactgccaaagtggctccgcctccgtctcct
tttccaccgcctaatcccaaccccaggccgttcgtgggaggcgggttgcctcatactccc
ggtgcggctcccaagagtgagccgggctggctggtggttcatgatgaaaatgctcccgag
cagacccactcgctgagagtcggtcggcaggtgatcggtcgtctgaatacgacagctccg
tgtgatatcatgatcaccactcaggatgtgtatatgagccgtaatcactgtatccttgaa
gtaaagcccggtcgaaccggagggtttgattatttattgtcagatcgcaaaatgaccaac
ggagcgcctgaactgatgagtgccaacggaacctatgtcaacgcttttgaaaaaccgctt
caacccaacgacatggtctatcttaatgacggtgataccattcagatcggacaaaccaaa
gtagttatcaaaacgatcaaaacggtcgccaacgctgacgatgccactcgattggtacga
gatacggactacacacccaccgtaattatcaaaaattaa

DBGET integrated database retrieval system