KEGG   Runella slithyformis: Runsl_5208
Entry
Runsl_5208        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: EF-hand_1
Other DBs
NCBI-ProteinID: AEI51508
Position
complement(6053230..6054618)
AA seq 462 aa
MNPIDFEKTRIFADKAKEASIPAAPVVPSIPQVQSPAAKPSIKKLTKEEKLLLAAGGVLS
VGLGAIVIANVIEEDTEPFTESEKPVIEAPVIEVDASVEPADAAKPLVSRPAPPVNVPSP
AKTDDRSHGLITIPEHPQVAEAVTDDMSFEEAFKVARNEVGPGGLFVWNDTYYGTFRESE
WEGLSEAKKDQWITAVEPIIDPQIPEPGPDPIAGDEHVVIADRGEIIWTGIDKNGDGVAE
ILTARVQGQPPIVMMDTDNDGRLDTRYFLDAASGQMASSSMEQTVMGMNDINEIPQIEPG
STFYTAGYRDSGGGGDLPVSIIEENGSYIVGIDTDGDALVDILALNQDGKEPFVAMDMDS
DGRVETSYTFHSEQQIVVSLENQPMEPMLLTDQEELPDPTYTAEVDDDVLDDDDLTHAHP
QREMPPAYAAHLPSVSEHHASAGDPDDMYFNNHSDAADDFVG
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgaatcccattgattttgaaaaaacccggatatttgccgataaagcaaaagaggcttca
attcccgctgcaccggtggtgccttcaataccgcaagttcagtcgcccgcggcaaaacca
tccataaaaaagcttacgaaagaagaaaagttattattggctgccgggggagtactctcg
gttgggttgggggctattgtcattgccaatgtaatagaagaagacacggaaccgttcact
gaatccgaaaaacccgtgatcgaggcgcccgtcattgaagtggatgcatccgtcgaaccg
gccgatgccgccaagccgctcgtttcccgacctgcccctccggtaaatgtcccctcaccg
gccaaaaccgacgatcggtctcatggcctgatcactattccggaacatccgcaggtcgcg
gaagcggtcacggacgatatgtcgtttgaagaagcttttaaagtggcccgtaatgaagta
ggccccggaggattattcgtctggaacgatacctattacggaaccttcagggaaagtgag
tgggaaggattatccgaagctaaaaaagaccaatggatcacggcggttgagcctatcatt
gaccctcagattcccgaaccgggtcctgatcctattgcgggcgatgagcacgtggtcatt
gccgacaggggggagattatttggaccggcattgataaaaacggcgatggggtggccgaa
attttaacggcgcgggtacagggacagcctccaatcgtaatgatggataccgacaacgac
ggtcggctggatacgcgttattttctggacgccgcttccggccagatggcttcctcgtcc
atggagcagacggtgatgggaatgaatgatatcaatgaaatccctcaaattgagcccgga
agcactttttatacggcaggataccgtgattccgggggggggggagatcttcctgtatcc
attattgaagaaaacggctcttacattgtcggcattgataccgacggagatgcgttggtc
gatattctggcgctgaatcaggatggaaaagagccttttgtggcgatggatatggacagt
gacggccgggtagaaacaagctatacctttcattccgagcagcaaatcgtggtgtcgctg
gaaaatcagccgatggagccgatgttgctgacggatcaggaagaactgcctgacccaacg
tataccgcagaagtggacgatgatgttttggacgatgacgacttaacccatgcgcatccc
caacgggaaatgccccctgcgtatgccgcccatctcccgtccgtttcagagcatcatgct
tcagcgggcgatcccgacgatatgtattttaacaaccactctgatgctgcggatgatttc
gtaggttaa

DBGET integrated database retrieval system