KEGG   Runella slithyformis: Runsl_5209
Entry
Runsl_5209        CDS       T01553                                 

Definition
(GenBank) Forkhead-associated protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AEI51509
Position
complement(6054638..6055372)
AA seq 244 aa
MSSQPKRVTVGRKPGNTIVLPNADVSGDHAILTLLDAPTNTWEIQDAGSRNGTFVDGQRI
LRKEVTPNNKVTFGSTPLIWSQLVTGAAKPPSTAKKVHESAKTEELKLDFFEVPIGERLR
NVYQDFMDKKSRMEEIQKQEALNARYQSLGLPIAGLFGASVGFLPSEYRYISIIGTLISL
SITVWSFAKSKKFTAEKRNLNMTKLTEQYDINYRCPYCQVRINDPFPVLLQIKNCRNCKK
PLIP
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagcagtcagcccaaacgcgtaacggtcggtcgaaaacccgggaatacgattgtgtta
cccaatgcagatgtaagtggagatcatgccattctcaccttgttggatgcgcccaccaat
acgtgggaaattcaggatgccggctcccggaacggtaccttcgtggatgggcagcgtatc
ctgcgtaaggaggtgacgcccaataataaagtcactttcggaagtacgccccttatttgg
agccaattggtgaccggcgctgccaaaccgccctcaacggctaaaaaagttcatgagtca
gctaaaaccgaggagttaaagcttgatttttttgaagtacccatcggcgaaagactcagg
aatgtgtaccaagacttcatggataaaaaaagccgaatggaggaaattcaaaagcaggaa
gcattaaatgcccgctatcaatcgttggggctgccgattgcgggattgtttggggcttcc
gtggggttcctgccgtctgagtatcggtatatttccatcatcggtacactgatctccctg
agtattacggtttggtcgtttgcgaaatctaaaaaatttactgccgaaaaaagaaacctt
aacatgacgaagctgacggagcagtatgatatcaattatcgctgtccgtactgccaggtc
aggatcaatgatccctttccggtacttcttcagattaaaaattgccgaaattgtaaaaag
cctctcatcccctaa

DBGET integrated database retrieval system