KEGG   Runella slithyformis: Runsl_5210
Entry
Runsl_5210        CDS       T01553                                 

Definition
(GenBank) PKD domain containing protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: VWA PKD_4 VWA_2 PKD MBG InlK_D3 VWA_CoxE CdAMP_rec
Other DBs
NCBI-ProteinID: AEI51510
Position
complement(6055401..6056975)
AA seq 524 aa
MDKSYPKTMNSTLHILRLFTGFCRQRGGILLLSLFWIFCPEGCKQKEPLPEPIADFSYTP
GQNLEAPVTITFMNNSQNADSFEWDFDDGTGSTLRNPVKRFTKGGTYTVTLTAKGGGGTR
TAFATIVIEENLYGGNNGKIGFWSKIGNEGFTSITINTGTQTLKSYWAATPDCTNGSLAS
FTLPAGDYSFVAVNDEGRRWKGSIRVTRAQCALWELKKEEGIVSLPSGAVIRSTATSRSG
QTIRFTLDIAMVNGDNSLSGNLSRSDFSIGGFSSNGVNYSFVNEGIQVLSGGPNVPYSAS
LLLDQSGSISGTDPQNHRIEAAKVFCQSLGQGDNVHLSAFASAGKIPYELTVYGNGFNSN
GSVYLGTLDNLKNQIGGGTPLCKSTYSMIDYVSKNAPNQNKALVVFTDGEDTGGGRTPDD
IIKLARQLNIKVFMMGLGTAEVQNLAYIANQTGGAFMFAREAPQLMTMFGSLGKLLNGTA
NYYRTSWTMTRSPGVGTSGSYWVTSSVQVKIGGRTVFVPFRVDY
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggataagtcatacccgaaaaccatgaattctacattacacattcttcggctttttaca
ggtttttgcaggcaaagaggagggatattgttgctgtcgcttttttggatattctgcccg
gaaggctgtaagcagaaagagccgcttccggagccgatcgcagatttttcatacactccc
ggacaaaacctcgaagcgccggtcactattacatttatgaacaattctcaaaatgccgat
tcatttgagtgggattttgatgacggcaccggctcgacactccgaaatcccgtgaagaga
tttacaaaggggggtacgtatacggttaccttaacggcaaaagggggagggggaacccgg
actgcatttgcgacgatcgtgattgaggagaatctatacggtggaaataacgggaaaatt
gggttttggtctaagatcggaaatgaagggtttacttccattaccattaataccggcacc
caaacgcttaaaagttattgggcagctacgcctgactgtaccaatggcagtttggcaagt
tttacgctgccggcgggagattacagcttcgtggcagtcaatgatgaggggcgtcgttgg
aaagggtcaatcagagtaacaagggcacaatgtgctttgtgggagttgaagaaagaggaa
ggtattgtttcattgccttccggagcggttatccgttcaacggccacttcacgcagtggg
cagaccattcggtttactctggatattgccatggtaaatggcgataactcacttagcggc
aacttgtcaaggtcagatttttccattggcggcttttcttcaaacggggttaattattca
tttgtaaatgagggaatacaggtgctttccggtggaccgaatgtgccttattctgcttca
ctgctgctggaccaaagcggcagtatatcagggactgatccccaaaaccatcgcattgaa
gcggccaaagtgttttgtcaatcgctgggacagggtgacaatgtacatctgagcgcattt
gcaagtgcgggcaagattccgtatgaattaaccgtgtatggaaatggatttaattcaaac
ggcagtgtttatttaggaacattagacaacctgaaaaatcagataggaggaggaacaccg
ctgtgtaagtcaacctattcaatgatcgactatgtcagtaaaaatgcccccaatcaaaat
aaggcgttggtggtttttaccgacggtgaagatacaggcgggggcagaacgccggacgat
atcatcaagcttgccagacagttaaacataaaagtatttatgatgggtttggggaccgcg
gaagttcaaaacctggcctacattgccaatcagacgggaggggcatttatgtttgcaaga
gaggcaccacagttgatgacaatgtttggctctcttggaaaattgctgaacggaacggca
aactattatcgaacgtcctggaccatgacccgtagcccgggcgtaggtacttcgggatcg
tattgggtcaccagttcggtacaggtaaagattgggggccgaaccgtttttgtccctttc
agagtagattattag

DBGET integrated database retrieval system