KEGG   Runella slithyformis: Runsl_5211
Entry
Runsl_5211        CDS       T01553                                 

Definition
(GenBank) ATPase AAA-2 domain protein
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rsi03110]
    Runsl_5211
Chaperones and folding catalysts [BR:rsi03110]
 Heat shock proteins
  HSP100
   Runsl_5211
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat AAA_22 AAA_14 TniB NACHT AAA_7 AAA_24 T2SSE AAA_33 IstB_IS21 TsaE AAA_18 RuvB_N Zeta_toxin Mg_chelatase ABC_tran Clp_N NTPase_1 AAA_29 AAA_30 AAA_19 Torsin Roc MCM FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: AEI51511
Position
6057176..6059680
AA seq 834 aa
MISTQLNDELIRAIQIAQAIAKEHQQGVYAPAHLLKGLLHNDVGLGALLVGWEIDINYLR
DWADYRIEKLPKSARGTLDMRPDPKTVAALEVADIIRLKLGDSSLSPLAVLIAITRPEVA
YTKDQLKSFPITETELLTFALQNIQAETTLSPASDEPSRAGGGNASFQALLKYCVDKTAL
ARQGKLDPIIGRDKETRTMVEILGRRSKPNVIIVGEPGVGKTALVEGLARLIIAGQVPAH
LQKAALFQLDMGALIAGASYKGEIEDRLKNIIAEVKRHERALLFIDEIHVLMDPQSGAMG
LVNLLKPELARGELTVIGATTLDEFRKFMEPDEAFSRRFELVRVDEPDETTASRMVGRVV
PLFEEHHQIKVGQGTVVETVRLARRYIKDRRLPDAAIDLIDRTMAAMKLMTETTQQEIDL
LRTELTELREEHAGGDPILYNQELRWFERQLRHRLSPILLGQLEEDTQLAQMELPEAVAE
LLTELLIRLQTLGGQRKETVETHDVAAVVAHKTGIPLGKLQSTEREKLLQLNEHLKKRVV
GQDHATKVIADAILENRSGLSRPGQPIGSFFFSGPTGTGKTELAKTMADFLFNDEKALIR
FDMSEFKEEHSAAVLYGAPPGYVGYEEGGLLVTKIRQQPFAIVLFDEIEKAHPSVFDLFL
QILDEGTLHDRLGREGDFSNAIILFTSNIGSEWIAGQFGQGQIPASNDILDLMTKHFRPE
FLGRLTEIIPFSPITESAVLNIFNIQLKPLIVLLEKQGITLNIDDEARKALALEGFTPKY
GARPIRGVIRNRIRRPLSRMIVAGEIGKGSTVTLKLGKDGEFDWENEPIIETIH
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgatttctacacaattgaacgacgaactcataagggctattcagatagcacaggccatt
gcgaaagaacaccaacagggagtgtatgcgccggctcatttactgaaagggctgctgcac
aacgacgtcggcttgggagcgctgcttgtcggttgggaaattgatattaattatctcagg
gattgggccgattatcgtattgaaaagctacccaaatcagcacgcggtacgctggatatg
cgtcctgatccgaaaacagttgccgcgcttgaagtagcggatattattcgactgaaactg
ggagattcgagcctttcgcccttagcggtcctgattgccattacccgcccggaagtggct
tatacaaaagaccaactcaaatcttttccgattacagagaccgagctgctgacgtttgcg
cttcaaaatatacaggcagaaaccacgctaagccctgcttccgacgaaccttcccgggcc
ggcggcggcaatgcctcatttcaggccctgctcaaatactgcgtcgacaaaaccgccctg
gcccgtcaggggaaacttgacccgatcatcggccgcgacaaagaaacccgtaccatggtc
gagatcctcgggcgacgctccaagcccaacgtcatcatcgtaggcgagccgggcgtagga
aaaaccgccctcgtcgaaggcctcgcccggctcatcatcgccgggcaggtgcccgcccat
ttgcagaaagccgccctgtttcaactcgacatgggggccctcattgccggtgcttcctac
aaaggagagatcgaagaccgccttaaaaatatcattgccgaagtcaaacggcacgaacgc
gcccttttgttcatcgacgagatccacgtcctgatggacccccaaagcggagccatgggg
ctggtcaacctgctcaaacccgaactggcccgcggggagctgaccgtcatcggcgccacc
accctcgacgagttccgtaaattcatggaacccgacgaagccttcagccgacgttttgaa
ctcgtcagggtcgacgagcccgacgagaccacggcgagtcgcatggtgggcagggtcgta
ccgctctttgaagaacatcaccaaatcaaagtgggccaaggcaccgttgtcgaaaccgtg
cgcctggcccgtagatacatcaaggaccgtcgcctgcccgatgccgccattgacctcatt
gaccgcaccatggcggccatgaagctcatgaccgaaaccacgcagcaggaaatcgatctg
ctgcgcacggaactcaccgagctgcgggaagaacacgcaggcggcgatccgatactatac
aatcaggaactgcgctggtttgaacgtcaactgcggcaccgcctcagcccgatcctgttg
gggcagttggaagaagatacgcaattggcacaaatggaactgcccgaagccgtggccgag
ttgctgacggagctgctgatccggctccaaacactgggaggacagcgcaaagagacggtc
gaaacgcacgatgtggccgccgtcgtcgcccacaaaacgggcattccgctgggcaagctg
caatctaccgagcgggagaaactcctgcaactcaacgaacacctcaaaaaacgggtggtc
ggacaggatcatgccaccaaagtcattgccgatgccattctggaaaaccgctcggggctg
agccgtccggggcagcccatcggttcgtttttcttctcgggcccgacaggcacgggcaag
acggaattggccaaaacgatggcggattttctgttcaacgacgaaaaagccctgattcga
ttcgacatgtcggagtttaaggaggagcattcagcggcggtactgtacggggcgcctccg
ggctacgtggggtatgaggagggcggtttgctggtgaccaaaatcaggcagcagcccttt
gccattgtgttgtttgacgaaattgaaaaagcgcacccttcggtctttgacctgttttta
cagatcctcgacgagggcaccctgcacgatcgattggggcgcgagggagatttcagcaat
gccatcattttgtttacgtccaatatcggctccgagtggatcgcagggcagttcgggcag
gggcaaatccccgcttccaatgacattctggacctgatgaccaagcacttccgtcccgag
tttttgggacgcctgacggagatcattcccttcagcccgatcacggagagtgcggtgctc
aacattttcaacattcagcttaagccgttgattgtcttactggaaaaacagggtattacg
ctcaatatagatgacgaagcgcgcaaagccttagccctggaaggttttacgcccaagtac
ggggcgcgtccgatccggggcgtgatccgtaaccgcatccgtcggccgctctcacggatg
atcgtggcgggagaaatcggcaagggaagcaccgtgacactgaaattgggaaaagacgga
gaatttgattgggagaacgagccaattatagaaacaatacattaa

DBGET integrated database retrieval system