KEGG   Runella slithyformis: Runsl_5212
Entry
Runsl_5212        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF2235
Other DBs
NCBI-ProteinID: AEI51512
Position
6059685..6060629
AA seq 314 aa
MPTQHILIAIDGTGSNEWRRSDGLNSHVYRFFNDFAGADKVYLDGPGTTGLDVGNIIDEG
VRITYLMIERLLRFERCRLEDININIIGHSRGGFIGVKIANLLSNPLTFIRPASSGSAER
VKFLNQRLGSSQALSSLKINFIGLYDAVKRTVTESEGDLSLRNVSRIAHSWRQNKSLSRL
TFEGMVIPSAANKPFDTSHGGVGGDPGFFTPLSFGNDLYCNALDLLNGDRSILGTIVEPI
DSVYSGMWRLHHGVTREERIRQVRHYWQNSIESDMFIREQASQCSVPLSGKSQHLPWEEK
NNHLGIQLKRLVSL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgccaacacaacatattttaattgccatagacggtacaggctcaaacgaatggcgtcgc
agtgatggattaaacagtcatgtatatcgtttcttcaatgattttgccggggccgataaa
gtatatctggacggtccgggaacaacaggattggatgtaggcaacattatagatgaaggg
gtaagaatcacttacttaatgatagaacgccttctcagatttgaaagatgccgtttggaa
gacatcaacatcaatataattggacacagtcgcggcggatttattggagttaaaatagcc
aatttgctttctaatccattgacttttattcgccctgcatcatcaggctctgctgaaaga
gtgaaatttttaaatcaacgcttaggaagtagtcaggcactttcatctttaaaaatcaat
tttattggcctatatgatgcagtcaaaagaacggtaacagaatcagagggtgatttatct
ttacggaatgtatccagaatagctcattcatggaggcaaaataagagtttatccagatta
actttcgagggaatggttatcccttcagcggcaaataaacctttcgatacctcacatggc
ggtgtcggtggagacccgggctttttcacgccgctttcattcggtaatgacctctattgt
aatgctcttgatttattgaatggagatcgctccattttgggaacaattgtcgaacctatt
gacagtgtttattcaggaatgtggcgtttgcatcacggagttactcgcgaggaacgaatc
aggcaagtgcgtcattattggcaaaattcaatagaatccgatatgttcattcgtgaacaa
gccagccaatgcagtgttcctttatcgggaaaatcacaacatttaccatgggaagagaaa
aataatcatttaggaatccaattaaaaaggcttgtttctctttag

DBGET integrated database retrieval system