KEGG   Runella slithyformis: Runsl_5213
Entry
Runsl_5213        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: T6SS_VipA IFT81_CH
Other DBs
NCBI-ProteinID: AEI51513
Position
6060683..6061138
AA seq 151 aa
MAIEKPQLGGVVIDEGTSEAIKLLHDNKTAIISKFTADSLSQEPVEGIQKLQDAFDHFQP
QVDISHTTEEGQEVNETLNFTNMTAFTVKGMIEQSGYLQELKGKEDDYQTLIKRLMTNKV
FQKLLADPAGKAAFVEALNAMIAELDEVDGE
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcaatcgaaaaaccccaattaggcggcgtcgtcatcgacgaaggaaccagcgaagcc
atcaagctgcttcacgacaacaaaacggccatcatcagcaaattcaccgctgactccctg
agccaggagcccgtggaaggtatccaaaaattgcaggatgcctttgatcattttcagcct
caggtagacataagtcataccaccgaagagggacaggaggtcaacgagacgctcaacttt
acgaacatgacggcctttacggtcaaaggcatgatcgagcaaagcggctacctgcaggag
ttgaaaggcaaagaagatgactatcaaaccctgatcaaacgcctgatgaccaacaaggtt
tttcaaaaattgctggccgaccccgccggcaaagcggcctttgtggaagccctcaacgcc
atgattgccgaattggacgaggttgacggtgaataa

DBGET integrated database retrieval system