KEGG   Runella slithyformis: Runsl_5214
Entry
Runsl_5214        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: TssC Phage_sheath_1C Baculo_F
Other DBs
NCBI-ProteinID: AEI51514
Position
6061192..6062565
AA seq 457 aa
MPLEEQAPQSKELVREKAAPSQAAPRPLTLIVPQLTKYGGFEFIKTIVDGTDNMDPAKKA
RKAMFLEEEENQADRQKLKKRLQAVADLLSAHDNVADMIAEAEQKAASASETLKANLRNC
LAQTEELERSYRSLALFFENTAEEKVKNLVLFDAGLEHTTDTDGFSNPTGIFEQVAKELR
DNYDRFDLTNNYSLIVLPGWLKKNIIVDKWAELAHQNKVMMITDYRHLDSAEDVEAMFDR
DKLTGSDAHKAHVMMPCNWVVGREANTDIGEEDHLFIPPSMALAGLLWGGNIAQPSAGLA
HGKLKMASGTRFTMRKNEVAQLENKGLIPLIYEWGRVVPQSAKTLFDGDNVGLQTYSVVR
VFDWIGKIMQDFLNRRTFENIDNRMLEDIKRQISKFLAEIRGPGKIIEDYRNLEVKRNPD
KPTHVIINVDLKPFFPAKVFAINMTGTKGNWDSELKP
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcctttggaagaacaagcccctcaatcgaaagaacttgtgcgggaaaaagccgcgccg
agtcaggccgcgccccgtcctttgaccctgatcgttccgcaactcaccaaatacggcggc
tttgaatttatcaaaaccatcgtcgacggtaccgataacatggaccccgccaaaaaggcc
cgcaaggccatgtttttggaagaggaagaaaatcaagccgatcgccaaaaactcaaaaag
cgcctccaggccgtcgctgacctgctttccgcccacgataacgtggccgatatgatcgcc
gaggccgaacagaaagccgcttcggcaagcgaaaccctcaaggccaatctgcgtaactgc
ctggcccagaccgaagaactcgaacgctcgtatcgctctctggcccttttctttgaaaat
acggccgaagaaaaggtaaaaaacctcgtgctgtttgatgccggtttggagcataccacc
gataccgacggcttcagcaatccgacgggcatctttgagcaggtggccaaagaactccgc
gacaattacgaccgcttcgacctgaccaacaattattcgctgatcgtactgcccggctgg
ttgaagaagaatatcatcgtcgataaatgggccgaattggcccaccaaaacaaggtcatg
atgatcaccgattatcgtcacctcgacagcgccgaagacgtggaagccatgtttgaccgc
gataaactgacgggctccgatgcgcacaaagcccacgtgatgatgccctgcaactgggtg
gtaggtcgcgaagccaataccgacatcggcgaagaagaccacctgttcattccgccctcg
atggccctggcaggcttgctttgggggggcaacatcgcccagccgtcggcaggcctggcg
cacggaaaactcaaaatggccagtggtacgcgcttcaccatgcgcaagaacgaagtggcg
cagttggagaacaagggcctgatcccgctgatctatgagtgggggcgggtggtgccgcaa
tcggccaaaacgctctttgacggcgacaacgtcggcctgcaaacgtacagtgtggtgcgt
gtgtttgattggatcggcaagatcatgcaggatttcctgaaccgccgcacgtttgaaaac
atcgacaacaggatgctggaagacatcaaaaggcagatctcgaagtttctggctgagatt
cgcggacccggcaagatcatcgaagattaccgcaatctggaagtgaaaagaaacccggac
aaaccgacgcacgtcatcatcaatgtggacctgaagccctttttccccgccaaagtattt
gccatcaacatgacaggtaccaaaggcaactgggattcggaacttaaaccgtaa

DBGET integrated database retrieval system