KEGG   Runella slithyformis: Runsl_5215
Entry
Runsl_5215        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: TssD MMgT Phage_T4_gp19
Other DBs
NCBI-ProteinID: AEI51515
Position
6062606..6062998
AA seq 130 aa
MAHKAEITIDSKKFEVLHCSYSLHQHVNPNTNETTSEVFGGNIDVTIETRNADAKIIELM
VLPHKDDVSGEIKFNNQKGEELRTIKFNHAAVVNFSETFSLSGSGTGSQSFTICARELDI
QGQKLNLKRD
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcacataaggcagaaattaccattgacagtaaaaaatttgaagtattgcactgctcg
tacagcttacatcagcatgtaaaccccaataccaacgagacaacctccgaagtattcggc
ggcaacattgatgttaccatcgaaacacgcaatgccgacgccaaaatcattgaactgatg
gtattaccgcacaaagatgacgtcagcggagaaatcaagttcaacaatcagaaaggcgaa
gagctgagaaccatcaagttcaaccacgccgccgtggtcaatttcagcgaaaccttcagc
ctttcgggcagcggcacgggctcacagagtttcaccatctgcgcccgtgagttggacatc
caggggcagaaactgaacctaaaaagagattag

DBGET integrated database retrieval system