KEGG   Runella slithyformis: Runsl_5216
Entry
Runsl_5216        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51516
Position
6063102..6064139
AA seq 345 aa
MEESGHYYTVYFVSLAVGFTNERSHEYAFYTQMPDEVEEFDAAFLEKKQFKNAGKFHAAK
QALKIAYSQLFPFTPMGVGALEESLARQEKILAKANQWRMIVELGLHSLTGKSAKDEQDK
TAKLLKSTKPDNMVRFGFLLHRYGDTFAHSRMDNPSKLYDTSENISSPTHRGHMLDGTHA
DHPWERETLYFQYVEGLYDILSTAKEKSRNDIGSTRRGKVLALHEIKNTLKRAINEARMW
SENEIKNYNAIDTTRCKPAIASGLFDACKKPEEAAQLFFSEIIRREVFFTLGINIHSYTP
ERNETVSLKQFLDPKNGYMNGISSAYSSEQLEKEIYKLLEEASGK
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggaagaatcagggcattattatacagtatactttgtatcgttagctgttggttttacc
aacgaacgctctcacgagtatgcattttatactcaaatgccggacgaagtggaagaattt
gatgctgcttttttagaaaaaaagcaatttaaaaatgcggggaaatttcatgcagccaaa
caagcccttaaaattgcttattcacaactgttcccgtttacacccatgggagtaggcgcg
ttggaagagtcattagctcggcaggaaaaaatactggcaaaggccaatcaatggcgaatg
atcgttgaactcgggcttcattcccttaccggtaagtctgccaaggacgaacaggacaaa
acagctaagttgctgaaaagtaccaaacccgataacatggtccggtttggatttttactg
catcggtatggtgacacattcgcccactcccggatggacaatccatcaaagctgtatgat
acaagtgagaatatttcaagcccgacccatcgagggcatatgcttgacggtacacatgcc
gaccatccatgggaaagagaaactctttattttcaatacgttgaaggattatatgatatt
ttatctacggcaaaggaaaagagcaggaacgatataggcagcacccgaaggggcaaagtt
ttagctctgcatgaaataaaaaacaccctcaaacgcgccataaatgaagcacggatgtgg
tcagagaatgaaataaaaaactacaatgccatagacaccacaagatgtaagccggccata
gcctcaggcttattcgatgcctgcaaaaaacccgaagaagcagctcaactgtttttttct
gaaattatcaggcgtgaagtattctttacactgggaatcaacattcattcttataccccc
gaacgaaatgaaacggtttctctaaagcaatttttagatccgaaaaatggatatatgaac
ggaatcagttctgcttattcttctgagcagcttgaaaaagaaatatataaattattggaa
gaagcaagtgggaaatag

DBGET integrated database retrieval system