KEGG   Runella slithyformis: Runsl_5217
Entry
Runsl_5217        CDS       T01553                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
rsi  Runella slithyformis
Pathway
rsi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Runsl_5217
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsi02044]
    Runsl_5217
Secretion system [BR:rsi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Runsl_5217
SSDB
Motif
Pfam: Phage_base_V Phage_GPD Sarcoglycan_1 DUF3540
Other DBs
NCBI-ProteinID: AEI51517
Position
6064212..6066005
AA seq 597 aa
MPSTIQLLAAVEININGLTLKRISSISISQPFENHHTFEISISPDMLPEKSTTIDLKKLA
EQVVGEVAVIKLKQGQKQEDGSIQEKQTRTFKGIATTIRLNKGSSTSNTIVISGVSNTAV
LSAGRTTRSFTDKSLGDIVQKVLSPFGGLSKKIAPSYTSPIRYVTQYEEDNFHFLQRLAE
EYGEWMFYDGEQFVFGKSGRDKGSEVTLKHGENIFDMQYSLRVTPLNLKGLNYDYYNHLT
YEAPSSGENVSGLGTFAMVGLHKSDAVFSDEPVEIGYQNHREKSTLKKAVRLKKSEQANK
LAVLTGRTPEMELKLGGIVKVVDTYVNDQNKAEVIDYGSFVVTRLSHYLDTRGVYQCHFE
AVPQDTDFAPADYRILSPNAEPQPAVVMQVDDKDSMGRVKVQFPWQKNDNEITPWIRVVH
PMAARDRGMYFIPEIDEVVFVDFEFGNPDVPFVTGSMYHGQAKPGDLFEAKNNIKGIITK
GGNHIIIDDTDGKEKIKIYNRESKNEIELSIDGEASIKAKSNGTIYLEAAKGIEMKAPKI
TMEADNEVDINAGNSVKVEGMTVDVNAQASGSFKTSAQLELNGGSMAVLKAAMVMIN
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgccctcaaccatacaactccttgcggctgtagagatcaatataaatggactgacgctt
aaacgtatcagcagtatttccatttcacagccttttgaaaatcaccataccttcgagata
agcatatcgccggatatgttgccggagaaatcgacaaccatcgatctgaaaaaactggcg
gagcaagtggtcggtgaggttgcggttatcaaattaaagcagggacaaaaacaggaagac
ggcagtattcaggaaaagcaaacccgtacctttaagggcattgccaccaccattcgtttg
aataaaggcagcagcacctccaataccattgttatttcgggcgtcagcaataccgcggta
ctgagcgccggacgcactacacgctcctttacggacaaatccctcggtgatattgtccaa
aaagtattgagtccttttggcgggctttccaaaaaaatagcgccttcctacacctccccc
attcgctatgtaacacagtatgaagaagataactttcattttctgcaacgtttggccgaa
gaatatggtgagtggatgttttacgacggcgagcagtttgtattcggcaaaagcgggagg
gataaaggcagtgaggtaacgcttaaacacggagagaacattttcgatatgcagtacagc
cttcgggtcacaccgctcaacctcaaaggcctcaattatgattattacaaccatttaacc
tacgaagcgccttcatcgggcgaaaatgtaagcggtttgggtacgtttgccatggtgggt
ctgcataaatccgatgctgtattcagtgacgagcctgttgagatcggctaccaaaaccac
cgtgaaaaaagcacattgaaaaaagccgtccggttaaagaaaagcgagcaggccaacaaa
ctggccgtccttaccggccgaactcccgaaatggaactgaaattgggcggcattgtcaaa
gtggtcgatacctacgtgaatgaccaaaacaaagcggaagttattgactatgggtcgttt
gtggtcacgcgtttgagtcattatctggatacaagaggagtatatcaatgccactttgag
gccgtaccgcaggatacggactttgctccggcagattaccgcatcctttcccccaacgcc
gaacctcaaccggccgtagtaatgcaggtggatgacaaagacagcatgggccgggtaaaa
gtacagtttccctggcaaaagaatgacaatgagatcactccctggatacgggttgtccat
ccgatggcagcccgggatcgcggaatgtactttatccccgaaatagacgaagtggtgttt
gtggattttgaattcggcaaccccgatgtgccgtttgtcacgggcagtatgtaccatggc
caagccaaacccggagacctgtttgaggcaaagaacaacatcaagggaatcattaccaaa
gggggaaatcatatcattattgatgataccgacggcaaagagaaaatcaaaatctataac
cgggaaagtaaaaatgaaatcgaactgtccatcgacggcgaggccagcataaaagccaaa
agcaacggcaccatttatctggaagccgccaaggggattgaaatgaaagccccgaaaatt
acaatggaagcggataacgaggtggatatcaatgccggaaacagcgtcaaagtcgagggc
atgaccgtagatgtaaatgcgcaggcttcggggtcgttcaaaacctccgctcagctcgaa
ttgaatggaggcagcatggcagtcttaaaagccgcaatggtcatgataaactag

DBGET integrated database retrieval system