KEGG   Runella slithyformis: Runsl_5218
Entry
Runsl_5218        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51518
Position
6066018..6066536
AA seq 172 aa
MKILRNVPFDLDRNTTETFRYNRFETALLEPGDLIYRIYTPNHNFVFKTPEDVKNPDTEG
MFWLDHFTYESLIRANQGEYIRGMTGRAMLAVKEEWNPLMSRIVTARVVSEIRAAYGYIK
WQPLTSVGGDSNVILMGGGAQLYIMVRDLSNITIISDRDIRPEAKVTTQLRF
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaaaatcctacggaatgtcccctttgatctggaccgaaataccaccgaaacgtttcgg
tacaaccggtttgaaacggctctgctggagcccggcgatctgatctatcggatttatacg
cccaaccataactttgttttcaaaaccccggaagacgttaaaaacccggataccgagggg
atgttttggctggatcattttacctacgaatccctgatcagggccaatcagggagaatat
atccggggtatgaccggtcgggccatgctggcggtcaaggaggagtggaatcctttaatg
agtcggattgtcacggcacgggttgtcagtgaaatcagagccgcttacggctatatcaaa
tggcaaccgctcacttctgtcggcggcgacagtaatgtcatattgatgggcggcggtgcc
cagctgtatatcatggttcgtgatttgagcaatatcaccatcatcagcgaccgggatatt
cgtccggaagctaaggtaacgacccaactgcgcttttaa

DBGET integrated database retrieval system