KEGG   Runella slithyformis: Runsl_5219
Entry
Runsl_5219        CDS       T01553                                 

Definition
(GenBank) GPW/gp25 family protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: GPW_gp25 Flt3_lig FtsH_ext
Other DBs
NCBI-ProteinID: AEI51519
Position
6066551..6067174
AA seq 207 aa
MSEPFYPIPPSFGALMKPQGAERNFVEELKTLHTYEEAIKRFGGEKKLQEFPLIDKLLKS
FSLSSFSELKQKLPFQELIDYLAEETIVQKITVEESIIQNINLYLSSKPKEFYFDREYGC
IVHNYDFRQLNDTPSKDQLKRTISDYLQKFEKRITVNTVSIEINDVQESVEGSHPRICRY
ITITIAGILVQTQERLREMKFRLVRYT
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtctgagccgttttatcctattcccccctctttcggtgccctgatgaaaccacagggc
gccgaaagaaactttgtagaagaactcaagacgctgcatacgtatgaggaagccataaaa
cgatttgggggtgagaaaaaactgcaggaatttccgctcattgacaaactgctcaaatca
ttttcattgagttctttttcagagcttaagcagaaactgccctttcaagaactgattgac
tatctggcggaagaaaccatcgttcaaaaaataacggtggaagaatccattatccaaaac
ataaatctttacctgtcttccaagccaaaggagttctatttcgatcgtgaatatggctgt
attgtgcataattatgatttcaggcaactcaacgacaccccgagtaaagaccagctgaaa
cgcacgatttccgattacctgcaaaaatttgaaaaacgtatcacggtcaataccgtcagt
atcgaaataaacgatgtgcaggaatcagtggaaggaagccatccgcgtatctgccgctac
atcaccatcacgatagccggtatacttgtccaaacacaggaacggctcagggagatgaaa
ttcaggctggtacgctatacttaa

DBGET integrated database retrieval system