KEGG   Runella slithyformis: Runsl_5220
Entry
Runsl_5220        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEI51520
Position
6067201..6069024
AA seq 607 aa
MYNDPKRYKTREYIRNEMIREVANLWNYDDSDVAIESFDPLVGMLLGAFATSIEGIHHEL
DNSRSRIIRRLAHLLTPDVLSGPQAAHAVMKVGIVDTSYTVSPQDIFTCNASGKEFHFTP
AGQYTLYNCKLAAQIIQNRVKTLGSAPRENFLNEILPHNEVWVGINMDSGPEEFDRLPFF
FDWRNDPARRSYLPLLGDVRMLTESGEELKIMPGLVNISPASGTADDFDPTAQAERMTQR
FYNAHFLSISNTHRQTGQRIVLQKKKHPEELASLLNPEELQKIFLQELVWIKIRFPGGMA
PDVLSRIVVDINAFPVLNRRALRPTFDLRPLFNVFPINVEESDFFFGIIDIETPMGIKLS
NSRQFTRDSTNQYLLRQGGVARFDERDASEMISYLTDLLRDESAMFMALGRGSLETDIEE
IRKHLERINKDLKKDSFPNWFVSVKTAEKSGRIVLNYWVTKADLANNIAFNTKLNRDRAN
KAFNDEMTVFLTTTQGGQRPLQGDEYLPVFRKALLTRGRIVTFEDYKAVCMSELGNQISE
VNVKKGFGVGSAQDQGLQQTVDIYLTPNPLKPQSREQWGELKARLLNSLEDQSSGIFPIR
IFVHGEQ
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtacaacgaccctaaacgctataaaacgcgagagtatatccgcaatgaaatgattcga
gaggtggcaaacctgtggaattatgacgacagcgatgtggccattgaaagcttcgaccct
ttggttgggatgcttttaggggcatttgccacaagtattgaaggtattcatcatgagttg
gacaactcccggagcaggatcattcggcgcttggcgcacttactcacgcccgatgttctt
tccggcccgcaggcagcccacgcagtcatgaaagtcggtatcgtggatacatcgtatacg
gtttcaccgcaggacatttttacctgcaatgcctccggaaaagagtttcattttaccccg
gccgggcagtacacattatacaattgtaagctggcggcccagatcattcagaaccgggtc
aagaccctcgggtcggctccccgtgagaattttttaaacgagatactgccgcataacgaa
gtgtgggtagggataaatatggacagtggaccggaagagtttgaccgtctaccgttcttt
tttgattggcgaaatgaccccgcccgacgctcataccttccccttttgggtgatgtacga
atgcttaccgagtcaggtgaggaacttaaaatcatgcccggcttagtgaatatcagcccg
gcctcgggcaccgcagatgattttgatcccaccgcgcaggccgagcgaatgacccaacgg
ttttacaatgctcacttcctgagtatcagcaacacgcatcgccaaacggggcagcgcatc
gtgcttcagaaaaagaaacaccctgaggaactcgcttccctgttgaatccggaggaatta
caaaagattttcctacaggagctggtttggataaagatccgatttcccggaggaatggcc
cccgatgtcctttcccgaatcgttgtagatatcaacgcttttcccgtcttaaatcggagg
gccctgcgtccgacgtttgacctgcgtcctttgttcaatgtatttccgatcaacgtggaa
gaaagcgatttctttttcggaatcattgatatcgaaacccctatgggcataaaactcagc
aacagccggcaattcacccgcgacagcacgaatcagtacttactgcgtcagggaggagta
gcgcgttttgacgaacgggacgcctcggaaatgatctcctacctgaccgatctgctgcgc
gacgaaagtgcgatgtttatggcactgggacggggcagtttggaaactgatattgaagaa
atcagaaaacacctcgagcgaatcaataaagatctgaaaaaagacagttttcccaactgg
tttgtctccgtaaaaacggcggaaaaaagcggcaggatcgtcctgaactattgggtaacg
aaggccgaccttgccaacaacatcgcatttaatacgaaactgaaccgagaccgcgccaac
aaggcttttaacgatgaaatgacggtattccttaccactacccaaggcggacagcgccct
ttgcagggcgatgagtatctgcccgtcttcagaaaagcgctcctgactcgcggaagaatc
gtaacctttgaagattataaagccgtatgcatgagtgagttgggcaatcaaatcagcgaa
gtcaacgtaaagaaaggcttcggtgtaggctctgcccaagaccaaggactgcagcaaacc
gtagatatttacctgacgcccaatccgcttaaaccccaaagccgggagcaatggggcgaa
ctcaaagcccggctgctgaatagcctcgaagaccaatcctcagggatttttcccatccga
atctttgtacacggtgaacagtaa

DBGET integrated database retrieval system