KEGG   Runella slithyformis: Runsl_5222Help
Entry
Runsl_5222        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TssN
Motif
Other DBs
NCBI-ProteinID: AEI51522
Position
6070061..6070909
Genome map
AA seq 282 aa AA seqDB search
MVFSIGTLVIFSSCLAIAVLSTALLYIQEASKINGIRLFLGALGLVLLFGITGVALSKTR
SLPVVFAVLSLLSSVSGIVYTVWGRRFFQWYTRESFASGMMTFIVWGGWAAAGFTTVYGL
ISPKATVFLADLIVGIVPIILPYLISKSYDFWLSIPQLKYKKWYYDPQVSLPVLEPINIV
RVNMQFTRIPDEPEPVFEGYWVELPGDKELGTLFHYFIYSHNNRHREHKKDPIRVDINGK
KMGWLLYKQNALGQRMYLNTDLSPVQNNITDNETIFAQSFSN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggtattttctataggtacattggtcattttcagtagctgccttgccattgccgtgctt
tctacagcgctgttatacattcaggaagcctccaaaataaacgggatcaggcttttttta
ggggctttaggtcttgtgctgctatttggcataacgggagtagcgctatccaaaacgcgc
tcacttcccgtggtctttgctgtactttccctgctctcctctgtatcgggcattgtttat
accgtttggggccgccgatttttccaatggtatacccgggagtcttttgcttcaggaatg
atgacatttattgtatggggcgggtgggccgcggcgggctttacaacggtatatggcctg
atttctccgaaggcgaccgtatttttagctgacttaatcgtggggatcgtacccattatc
ctgccttacctgatcagtaaatcctatgatttttggctcagcatcccccaactgaaatac
aaaaaatggtattatgaccctcaggtatctctgcccgtattggaaccgatcaatattgtc
agagtaaacatgcagtttaccagaatccccgatgagccggaacctgtatttgaagggtat
tgggtagaattgcccggcgacaaagaactgggcacattgtttcattattttatttactcg
cacaacaaccgtcatcgagaacacaaaaaagatccgatcagggttgatatcaacggaaaa
aaaatggggtggctgctgtataaacaaaatgcgttgggtcaacgcatgtatttaaacacc
gacctttcgccggttcaaaataacatcacggacaatgaaacgatcttcgcacaaagtttt
tcaaattaa

DBGET integrated database retrieval system