KEGG   Runella slithyformis: Runsl_5223
Entry
Runsl_5223        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: T6SS_VasE DUF2277
Other DBs
NCBI-ProteinID: AEI51523
Position
6070915..6072027
AA seq 370 aa
MFLPEIKYNFVNWRDGMKITQKHFTENDFAAKDAIRDIAAIHTTNFSYGLLSADDGMTSA
LSAPILAGDVIQITECRGITPGGVRIEWKSLKDHPVLSLSLLDYKFKLGSAGVFYVVIKA
DPFKTVEVGEYTGDDGLNRRPYLAVKPTLDLLSMHDMLSDAYSFPICRLRFENQRFSIDH
EYIPPSVNIHGEGLLWYYESCGTLLNNIQQLAVQIVRKIGGMQNRSSVAVDIHRILEKVL
IHCAESMDYYRIVVKELSPVYMAEYFMRLARMFRISFDCLPETNAAVLFNYFQNTIAGTT
GVFKTPVSAASKSLIDSMIDNVLISQYSHNDSTMLFDSIVRFLDFMDFFLQKLITLNYAD
NKGSWDIYAK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgttcttacctgaaattaaatacaattttgtcaattggcgtgatggaatgaaaatcacg
caaaagcattttaccgaaaatgactttgccgcgaaggatgccatcagagatattgcagcc
attcataccactaatttcagctatggactgctttctgcggatgacggtatgacctcggct
ttatcagcgccgatattggcaggcgacgtgatacagatcaccgaatgcaggggtatcact
cccggaggcgttcgtattgaatggaaatcgttaaaagaccatcctgtactcagtttatca
ttgctggattataaattcaaacttggctcagccggggtattttacgtcgtcatcaaggca
gaccctttcaaaaccgttgaagtaggcgagtataccggtgacgacgggttgaaccgacgc
ccgtacctggccgtcaaacccaccttggatttgctctcaatgcatgacatgctctcggat
gcgtacagttttccgatctgccgcctgcgctttgaaaatcagcgtttttccattgaccac
gaatacattcctccatcggtcaatattcacggggaagggttgttgtggtattacgaaagt
tgcggtaccttattgaataacattcagcagttggccgtgcaaatcgtccgaaaaatcggc
ggtatgcaaaacagaagcagcgttgcggtagatattcaccgaattttggaaaaagtactt
attcactgtgccgaatccatggattattatcggatcgtggtcaaagaactgtcgcccgtg
tatatggctgaatactttatgaggctggcccgcatgtttcggatctccttcgactgcctg
cccgaaaccaacgctgcggtcctttttaattatttccaaaataccatcgccggcactacc
ggtgtctttaaaacaccggtatcggccgcctcaaagtcgctcattgattccatgatcgac
aacgtactgataagccaatacagtcataacgacagtacgatgctgtttgacagtatcgta
cggtttttagactttatggattttttcttacagaaactcatcacgctcaactatgctgat
aataaaggcagttgggacatttatgcaaaataa

DBGET integrated database retrieval system