KEGG   Runella slithyformis: Runsl_5225
Entry
Runsl_5225        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51525
Position
6072383..6072862
AA seq 159 aa
MNKPSVFIGLSLLSVICIALLFVLVGKPYNSSSDNPTLSSSDESRFIADVKELDTLYLKL
QKAAYLKDVKATAQVNIRWEKQKDAFLTRYTSNPVLAKLAAQVHNNYRQRVKVLKETYRM
KAVTFSKAEQLKEAITSEEAQKEELKAENQMIKQALLTL
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaacaaaccgagtgtgtttatcggtctaagtctcctttcggtcatttgcattgccctg
ctatttgttttggtgggaaaaccgtataactcttcctccgacaatccaaccctttcttcc
tccgacgaatcgcgattcattgccgatgtcaaagagctggacacgttatacttaaaactg
cagaaagcggcttaccttaaagatgtcaaggccactgcacaggtaaacatccgctgggaa
aaacaaaaagatgccttcctgacgcgctatacctccaatccggttttagccaaattggcc
gcgcaggtgcataataactaccggcagcgggtgaaagtgctcaaagaaacgtatcgaatg
aaggctgttacgttttcaaaagccgaacagctgaaagaggccatcacgtctgaagaggcc
caaaaagaagaattgaaagctgaaaatcaaatgatcaaacaggcattgcttacgctgtaa

DBGET integrated database retrieval system