KEGG   Runella slithyformis: Runsl_5226
Entry
Runsl_5226        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF3810
Other DBs
NCBI-ProteinID: AEI51526
Position
6072879..6073358
AA seq 159 aa
MIQAENADIRAQKIRQFIITNIGFILICSFFFYWALVRIPAVYQHDRTLTAARLNEFLSN
TAKADTLVTQIQSTSNIRQKSMVDFYEWMNALKESYPQPLFQCVLDSYLKRVDEIENARQ
RDTSLLSLEQRYQTIKAETTALLAQNAALKQELAQKKAQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgatacaagctgaaaatgccgacatccgagcccaaaagatccgccaatttatcatcacc
aacattggatttattctgatctgctcgtttttcttttattgggcattggtcagaattccg
gcagtataccaacacgaccgtacgcttaccgccgcccgtctgaatgagtttttgagcaat
acggccaaagcagatacactggttacccaaattcagtcaacatcgaatattcggcagaaa
tcaatggttgacttttatgaatggatgaatgccctgaaagaaagctaccctcagcccctt
tttcagtgtgtgctcgacagctatctgaagcgcgtggatgaaattgaaaatgcccgtcaa
agggatacctccctgctgagtttggagcaacgataccaaaccatcaaagctgaaacgact
gccctgcttgctcaaaatgcagctctcaaacaggaattagcccaaaagaaagctcaataa

DBGET integrated database retrieval system