KEGG   Runella slithyformis: Runsl_5227
Entry
Runsl_5227        CDS       T01553                                 

Definition
(GenBank) Rhodanese-like protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-ProteinID: AEI51527
Position
complement(6073390..6073692)
AA seq 100 aa
MNTYHDISLSEVETMAQQPLAVIVDVREPWEFEEFNIGGINIPLADIRERRPELHHYQTL
IVVCTNGTRSRVAAKDYGRAEEFQHKHICHLKGGILEVED
NT seq 303 nt   +upstreamnt  +downstreamnt
ttgaatacctatcacgacatatcgctttcagaagtcgagaccatggcgcagcaacccctt
gctgtcattgtggatgtacgggagccctgggagtttgaagagtttaacatcggcggcatt
aatatccctctcgccgatatccgcgaacgccgcccggaactgcatcattaccagaccctt
attgtggtttgcaccaacggcacccgctcccgcgtggcggctaaagattatggccgcgcc
gaagaatttcaacacaagcatatttgccatctcaaaggaggtatactggaggtggaggat
taa

DBGET integrated database retrieval system